KEGG   Spirosoma linguale: Slin_0426Help
Entry
Slin_0426         CDS       T01156                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sli  Spirosoma linguale
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sli01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sli00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(530558..531637)
Genome map
AA seq 359 aa AA seqDB search
MAKPDAETGNPYLCGMTKPVLVLKFGTASITKPNGEPNEPVMVDIARQVAALHTRYRIVL
VSSGAVGAGKSLIREYRGDITQRKAAAAVGNLLLLNQYSRFFSIYGISIAQSLCERHHFA
DRDQFLQLKQTYEELWANDLIPIANENDVVSNRELKFSDNDELATLIAVGFGAEALMLCT
SVGGLLDADGTIIREVKDFDERIFGVVRTDKSSLGLGGMASKLTFAKLATRMGIRVVIFG
LSEPDSIRRALDREVGTEFTPQPTVLSARNRWLGSGSLAVGRVQIDAGAVRALQQRRSLL
AVGVRAIVGEFATGEMIEILDDEQKTIAVARARISSETLAQQLNQQNVEVANANDIVLL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccagacgccgaaacgggaaacccgtatctttgcggcatgacaaaacccgtt
cttgttcttaaattcggtactgcttccatcacgaaacccaatggtgagccgaatgagccg
gttatggtagacattgcccgccaggtagctgccctgcatacgcgctatcgtattgtcctg
gtatcgtccggggccgttggcgcgggcaaatcgctgattcgtgaataccggggcgatatt
acccagcgtaaggccgcagccgcagttggtaatctgctcttgctcaatcaatactcccgt
ttcttctcgatatacggcatttcaatcgctcaaagtctgtgcgaacgacaccattttgcc
gaccgcgaccagttccttcagctaaaacaaacgtacgaagagctttgggctaatgatctg
attcccatcgcaaacgagaacgacgtcgtgagcaaccgcgaactgaagttttcggataac
gacgaactggctacgcttattgcggtaggctttggcgctgaagccctgatgctttgcacg
tccgttggtgggttgctggatgccgacggcaccattatcagggaagtaaaagacttcgac
gagcgcatattcggcgtagttcgaacggataaatcttccctcgggttgggcggtatggcc
tccaaattaaccttcgccaagctggctacccgcatgggtattagggtcgttatttttggg
ttgagcgaaccggatagtatcaggcgggcccttgatcgtgaagtaggtaccgaatttaca
cctcaacccaccgttctctctgcccgaaaccggtggctcggctcaggaagcctggcagta
ggccgggtacagatcgatgcaggcgccgttcgggcgctgcaacagcgaagaagcctgctg
gccgttggtgttcgggcgatagtgggcgaatttgccacgggcgaaatgattgaaattctg
gacgacgaacagaagacaatcgccgttgcccgcgcccgaatttcgtccgaaacactggct
caacagcttaatcagcaaaatgtggaggtcgccaatgcgaatgatattgtacttttgtaa

DBGET integrated database retrieval system