KEGG   Spirosoma linguale: Slin_0529Help
Entry
Slin_0529         CDS       T01156                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sli  Spirosoma linguale
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slin_0529
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_0529
   00020 Citrate cycle (TCA cycle)
    Slin_0529
   00620 Pyruvate metabolism
    Slin_0529
Enzymes [BR:sli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Slin_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649130..650890
Genome map
AA seq 586 aa AA seqDB search
MAELIRMPKMSDTMTEGVIAEWHKKVGDKVKSGDVLAEVETDKATMDLEAYDEGTLLYIG
VEKGASVPVDGVLAVIGADGEDYKAVLNGSSGGSQDAAPAAPKPEPAPAPANSASAEATT
KLPDEKAVSAAPAENVNASIIRMPKMSDTMTEGTIVAWHKKEGDTVKSGDVLAEVETDKA
TMDLEAYEEGTLLYIGVKEGSSVAVDEVIAVVGEKGANFKVLLDGGSGAPAAGQQAATGE
SGSATAQQNPQADLPANADSDLSYAGGEGDAVGSNGRVKASPLAKRIAEEKGINLAQVQG
TGPEGRIVKSDVESFVPGKAAPAAQPTAPAAQPVAQPAAPAPAAAPAPAPAPTPAATSVG
GDYEDIPVSQMRKTIARRLSESLFTAPHFYLTMEINMDKAMDLRGTVNGLSPVKVSFNDF
VIKAAALALKQHPNVNSSWLGDKIRKYKYVNIGVAVAVDEGLLVPVVRNADQKTLSTISG
EVKDLAGKAKDKKLQPKDWEGSTFSISNLGMFGIEEFTAIINPPDSCILAVGAIKQTVKF
EGEIAKPTNVMKVTLSCDHRVVDGATGSAFLQTFKQLLEDPMRMLV
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaatccgaatgcccaaaatgagcgacacaatgaccgaaggcgtcattgcg
gagtggcacaaaaaagtgggcgataaagtaaagtccggcgacgtactggccgaagttgaa
actgataaagcaaccatggacctcgaagcatacgacgaggggacattgctctacatcggt
gttgaaaaaggggcttcggtgccggtagatggcgttctggccgttattggagcggatggt
gaagattacaaagctgtactcaacggatcgagtggaggaagtcaggatgctgccccggcg
gctcccaagccagaaccggctcctgcacctgccaatagcgcgagtgctgaagcgacaaca
aaactgcccgatgagaaagctgtatctgcggctcccgccgagaatgtaaatgcgtcgatt
atccggatgcccaaaatgagcgataccatgacggaaggaaccatcgtggcgtggcacaaa
aaagaaggggataccgtaaaatcaggtgacgtactggccgaagtcgaaaccgacaaagcg
actatggatctcgaagcctatgaggaaggtacacttctctatatcggtgtaaaagaaggt
tcgtcggttgcggtcgatgaggtcattgccgtggtcggtgaaaaaggtgctaatttcaaa
gtactgcttgacggtggttcgggtgcgcccgcagcaggtcagcaggccgctaccggcgaa
agtggtagcgcaacggctcagcagaacccacaggcagatttacccgccaatgctgattcg
gatttgtcgtatgccggtggtgaaggcgatgctgtcgggtcgaatggcagggtgaaagcc
tcgccattagccaagcgtattgccgaagaaaaaggcatcaatctggcacaggtgcagggc
actggccccgaaggtcgtatcgtgaaaagcgatgtcgaatcgtttgtgcctggcaaagca
gctccggccgctcaaccaacggctccggctgcccagccagtggctcaaccagccgcaccg
gctcccgctgcagcgccagctccggcaccagcgccaaccccagccgcaacctccgttggg
ggagattacgaggatattccggttagccagatgcgcaaaaccattgctcgtcgtctgagc
gagagtctgtttactgctccgcacttctacctgaccatggaaattaacatggataaggcg
atggacctgcgcggtacggtgaatggacttagcccagtgaaagtatcgttcaatgatttc
gtgatcaaggcggctgccctggcgctgaaacaacacccgaatgttaactcgtcgtggtta
ggcgataaaatccggaagtacaagtacgtaaacattggcgttgcggtagccgttgatgaa
ggcttgcttgtacccgttgtacggaacgccgatcagaaaaccctgtcgacgatttcgggc
gaagtgaaagatctggccggaaaagccaaagacaaaaaacttcagccgaaagactgggaa
ggcagcacattctcgatttccaacctcggtatgtttggtatcgaagagtttacggccatc
atcaacccacccgattcatgcattctggccgttggtgccattaagcagactgtgaagttt
gaaggtgagatagctaaaccaacgaatgtgatgaaagtaaccctgtcctgcgaccaccgt
gtggtagacggtgctacgggctcggccttcctgcaaacgttcaagcaactgctcgaagat
ccgatgcggatgctggtataa

DBGET integrated database retrieval system