KEGG   Spirosoma linguale: Slin_0981Help
Entry
Slin_0981         CDS       T01156                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sli  Spirosoma linguale
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slin_0981
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slin_0981
   00640 Propanoate metabolism
    Slin_0981
   00660 C5-Branched dibasic acid metabolism
    Slin_0981
Enzymes [BR:sli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Slin_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1195058..1196275)
Genome map
AA seq 405 aa AA seqDB search
MNIHEYQGKEILKKYGVRIQEGIVAESPEKAVEAAKLLIAQSGQKFVVVKSQIHAGGRGK
GQIVGSEQRGVALAKSVDAVRDITKNLIGNILVTHQTGPEGKRVNKVLIAEDVYYPGPSE
PKEMYIGILLDRTKACNVIMASTEGGMDIEEVAEHSPEKIVKEWIDPAVGLQPFQARKVA
FGLGLEGEAFKEMVKFVTALYKAYVDTDASMFEINPVLKTSDNKILAVDAKVNLDDNALY
RHLDLKAMRDLAEEDPLEVEASANDLNYVKLDGNVGCMVNGAGLAMATMDIIKLSGGEPA
NFLDVGGGANAKTVEAGFRIILKDPNVKAILINIFGGIVRCDRVATGVVEAYKAIGDIPV
PIIVRLQGTNAEEGAKIIDESGLKVQSAVLLKEAAEKVRQVVEAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacacgagtatcagggcaaagaaattctcaaaaagtacggtgtccgcattcag
gagggtatcgttgctgagtcgcccgagaaagccgttgaagccgccaaactcctgattgcc
cagtctggtcagaagtttgttgtggtaaagtctcaaattcacgctggtgggcgcggaaaa
ggccaaatcgttggttctgaacagcgtggcgtggcgttagccaagtcggtcgatgcggtt
cgcgacataacgaaaaacctcattggcaacatactggttacccaccagacgggtccggaa
ggcaagcgggttaacaaagttctgattgccgaggacgtatactatccgggtccttcggag
cctaaggaaatgtacattggcatcctgctggaccgtaccaaagcctgcaacgtcattatg
gccagcactgaaggtggtatggacattgaggaagtagccgaacattcgcccgagaaaatt
gtcaaagaatggattgatccggctgttggtctacaaccattccaggctcgcaaagtagct
tttggacttggtctggaaggcgaagcgtttaaagagatggttaagttcgttaccgctctt
tacaaagcgtatgtcgatacagatgcgtcaatgttcgagattaaccccgtgctgaaaacg
tcagacaacaagattctggccgttgatgcaaaagtgaacctcgacgataacgcgctatac
cgtcacctcgacctgaaagccatgcgcgatctggccgaagaagaccccctcgaagttgaa
gcatcagccaacgacctgaactatgttaaactcgacggtaacgtgggttgcatggtaaac
ggtgctggtctggctatggctacgatggacatcattaaactgtcgggtggtgaacctgcc
aacttcctcgatgttgggggtggtgcaaatgccaaaaccgttgaagctggtttccggatt
atcctgaaagacccgaacgtgaaggctatcctgatcaacatcttcggtggtatcgttcgc
tgcgaccgcgtagctacgggtgttgttgaagcgtacaaagccatcggcgatattccggtg
cctatcattgttcgcttacaaggtacaaatgccgaagaaggcgccaaaatcattgatgaa
tcaggcctgaaagtacagtcggctgtcttgctgaaagaagcagcggagaaagtacgtcag
gttgttgaagccctataa

DBGET integrated database retrieval system