KEGG   Spirosoma linguale: Slin_0981Help
Entry
Slin_0981         CDS       T01156                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sli  Spirosoma linguale
Pathway
sli00020  Citrate cycle (TCA cycle)
sli00640  Propanoate metabolism
sli00660  C5-Branched dibasic acid metabolism
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01120  Microbial metabolism in diverse environments
sli01130  Biosynthesis of antibiotics
sli01200  Carbon metabolism
Module
sli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slin_0981
   00640 Propanoate metabolism
    Slin_0981
   00660 C5-Branched dibasic acid metabolism
    Slin_0981
Enzymes [BR:sli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Slin_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 8724711
NCBI-ProteinID: ADB37032
UniProt: D2QJ18
Position
complement(1195058..1196275)
Genome map
AA seq 405 aa AA seqDB search
MNIHEYQGKEILKKYGVRIQEGIVAESPEKAVEAAKLLIAQSGQKFVVVKSQIHAGGRGK
GQIVGSEQRGVALAKSVDAVRDITKNLIGNILVTHQTGPEGKRVNKVLIAEDVYYPGPSE
PKEMYIGILLDRTKACNVIMASTEGGMDIEEVAEHSPEKIVKEWIDPAVGLQPFQARKVA
FGLGLEGEAFKEMVKFVTALYKAYVDTDASMFEINPVLKTSDNKILAVDAKVNLDDNALY
RHLDLKAMRDLAEEDPLEVEASANDLNYVKLDGNVGCMVNGAGLAMATMDIIKLSGGEPA
NFLDVGGGANAKTVEAGFRIILKDPNVKAILINIFGGIVRCDRVATGVVEAYKAIGDIPV
PIIVRLQGTNAEEGAKIIDESGLKVQSAVLLKEAAEKVRQVVEAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacacgagtatcagggcaaagaaattctcaaaaagtacggtgtccgcattcag
gagggtatcgttgctgagtcgcccgagaaagccgttgaagccgccaaactcctgattgcc
cagtctggtcagaagtttgttgtggtaaagtctcaaattcacgctggtgggcgcggaaaa
ggccaaatcgttggttctgaacagcgtggcgtggcgttagccaagtcggtcgatgcggtt
cgcgacataacgaaaaacctcattggcaacatactggttacccaccagacgggtccggaa
ggcaagcgggttaacaaagttctgattgccgaggacgtatactatccgggtccttcggag
cctaaggaaatgtacattggcatcctgctggaccgtaccaaagcctgcaacgtcattatg
gccagcactgaaggtggtatggacattgaggaagtagccgaacattcgcccgagaaaatt
gtcaaagaatggattgatccggctgttggtctacaaccattccaggctcgcaaagtagct
tttggacttggtctggaaggcgaagcgtttaaagagatggttaagttcgttaccgctctt
tacaaagcgtatgtcgatacagatgcgtcaatgttcgagattaaccccgtgctgaaaacg
tcagacaacaagattctggccgttgatgcaaaagtgaacctcgacgataacgcgctatac
cgtcacctcgacctgaaagccatgcgcgatctggccgaagaagaccccctcgaagttgaa
gcatcagccaacgacctgaactatgttaaactcgacggtaacgtgggttgcatggtaaac
ggtgctggtctggctatggctacgatggacatcattaaactgtcgggtggtgaacctgcc
aacttcctcgatgttgggggtggtgcaaatgccaaaaccgttgaagctggtttccggatt
atcctgaaagacccgaacgtgaaggctatcctgatcaacatcttcggtggtatcgttcgc
tgcgaccgcgtagctacgggtgttgttgaagcgtacaaagccatcggcgatattccggtg
cctatcattgttcgcttacaaggtacaaatgccgaagaaggcgccaaaatcattgatgaa
tcaggcctgaaagtacagtcggctgtcttgctgaaagaagcagcggagaaagtacgtcag
gttgttgaagccctataa

DBGET integrated database retrieval system