KEGG   Spirosoma linguale: Slin_1006Help
Entry
Slin_1006         CDS       T01156                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sli  Spirosoma linguale
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Slin_1006
Enzymes [BR:sli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Slin_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1221859..1222584
Genome map
AA seq 241 aa AA seqDB search
MNGQPVNGNHKNGYALDGDYTDELVDEIGDAHGATSIDTPMRPDAFVLDDALKIDLIEEH
FREIMTILGLDLTDDSLKGSPRRVAKMYVNEVFSGLNPANKPKSTLFDNKFRYNEMLVEK
DITVQTYCEHHFVPILGKAHVAYISSGKVIGLSKLNRIVEYFSKRPQVQERLTVQIAEEL
KRVLETEDVAVIIDAKHLCVSTRGVHDVNSSTITSSYGGKFSEEATKQELLRFVTQPSVS
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgaatggtcaaccagtaaatggtaaccacaaaaatggatatgcactggatggagattat
accgacgaattagtggatgaaatcggtgatgctcatggagcaacctccattgatacacca
atgcgtcctgatgcctttgtccttgacgatgcattgaagattgacctcatcgaagaacat
tttcgggagataatgaccattctgggtctcgacctaaccgacgacagtctgaaaggttca
cctcgtcgcgtggctaaaatgtatgtgaatgaggtatttagcggattaaaccctgctaac
aagcctaaatcgaccttgttcgataataagtttcggtacaacgaaatgctggtagagaaa
gacattaccgttcagacctactgtgagcaccattttgtgcccattcttggcaaagcacat
gtcgcctatatttccagtggtaaggtcattggcttgtcgaaactgaatcggatcgttgag
tattttagcaagcggcctcaggttcaggagcgtttaacggtgcagattgccgaagaactg
aagcgtgttctggaaacagaagatgtagcggtgatcattgacgccaagcacttgtgtgta
tctaccagaggtgtacacgacgtgaatagctctaccattacgtcttcgtacggtggtaag
ttttctgaagaagccactaaacaggaacttctccgtttcgtgacgcagcccagtgtgagt
atttaa

DBGET integrated database retrieval system