KEGG   Spirosoma linguale: Slin_1032Help
Entry
Slin_1032         CDS       T01156                                 

Definition
(GenBank) CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
sli  Spirosoma linguale
Pathway
sli02020  Two-component system
sli02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sli00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Slin_1032
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Slin_1032
Enzymes [BR:sli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Slin_1032
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Slin_1032
Two-component system [BR:sli02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Slin_1032
Bacterial motility proteins [BR:sli02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Slin_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-GeneID: 8724762
NCBI-ProteinID: ADB37083
UniProt: D2QJ69
Position
complement(1255475..1256086)
Genome map
AA seq 203 aa AA seqDB search
MAETKLKNPTEAILIGGSTGSIEVLLRVLPALTTPLSFALIIVLHRKNTADSTLANLLSL
KTDSPFREVDDKDPIRPGTIYLAPADYHLLIEQDKSFSLDDSEKVNYSRPSIDVTFESAA
DVYRSSLIGILLSGANADGTKGMQAIQKTGGLLVAQHPDTALVGFMPQQAIANTTIDYVL
DIDGLIEFLKSVNTSQQTNHEAR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacaaagctaaaaaacccgacagaagctatccttattggtggctctaccgga
agcattgaggtactgctccgtgtattgcccgccctgaccactcccctgtcgtttgccctg
attattgtgctgcatcggaagaacactgccgattcgaccctggcgaacctgttatcgctg
aaaacagacagcccttttcgggaagtagacgacaaagatcccataaggccgggtacaatt
tacctggcccctgccgactatcatttactgattgaacaagacaagagtttttcgctggac
gattccgaaaaagtgaactacagccgcccgtccatcgacgtcaccttcgagtcggcggcc
gatgtataccgctcctccttgattggaattctgctgtcgggagccaacgccgacgggaca
aagggcatgcaggctattcaaaaaaccggcggcttgctcgttgcccaacaccctgacacc
gccctggttggctttatgcctcaacaggccattgcaaacaccactatcgattatgtgctg
gacattgacggtctgatcgagtttttgaagtcggtgaatacctctcagcaaacgaaccat
gaggcccgatga

DBGET integrated database retrieval system