KEGG   Spirosoma linguale: Slin_1235Help
Entry
Slin_1235         CDS       T01156                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sli  Spirosoma linguale
Pathway
sli00010  Glycolysis / Gluconeogenesis
sli00052  Galactose metabolism
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01120  Microbial metabolism in diverse environments
sli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_1235
   00052 Galactose metabolism
    Slin_1235
Enzymes [BR:sli01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Slin_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 8724968
NCBI-ProteinID: ADB37285
UniProt: D2QL46
Position
complement(1506786..1507949)
Genome map
AA seq 387 aa AA seqDB search
MKFLPQLLSLALLTSCLTMTSCSSKKENESDDQKPGIEKTTYGQLPDGQTADLYTLRNAA
GMTAQITNYGGIIVGLKTPDKDGKFEDVTLGQDSLSSYVKNNPYFGALIGRYGNRIAKGK
FTLDGKTYDLFINNMGNHLHGGKVGFDKVLWTATPVEGDEPALKLAYTAKDGEEGYPGNL
SVEVTYTLQKDNALKIDYKATTDKPTVVNLTNHTYFNLTGGAKRDILDHVVTLNADKLIA
VDQTLIPTGELKPVAGTPFDFLKPSVVGSRINDSTDTQIKYGGGYDHGWVLNGSGDSLKL
AATVYEPTSGRVMEVRTTEPAIQFYTGNFLDGSVTGREGFPYKKRYALCLETEHYPDSPN
HPAFPTTELKPGQTYKSTTIYQFSTKK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttgccccaactcctatcgctggctctgttaacaagttgcctaactatgacc
tcttgctcttctaaaaaagaaaacgaatccgacgaccaaaagccgggtatcgaaaaaacg
acctacgggcaactccccgacggacaaacggctgatctctataccctacgcaacgcagcc
ggtatgacagcccagattaccaactatggcggcatcattgtaggcttgaaaacgcccgac
aaagatggcaagtttgaggatgttacattagggcaggactcgctgtcaagttatgtaaag
aacaacccttatttcggcgcgctgattggccggtatggcaaccggattgccaaaggtaaa
tttaccctcgatggcaagacctacgacctgttcatcaacaacatgggcaaccacctgcat
ggcggtaaagtaggtttcgataaagtactctggacagccactccagttgagggcgacgag
cccgcacttaagctggcgtacacggcaaaagatggcgaagaaggctatccaggcaacctg
tcggtggaagtaacatacacgctgcaaaaagacaatgcccttaagatcgattataaagcc
acaacagacaaaccaacggtggtgaacctgaccaaccacacgtatttcaatctgacgggt
ggtgccaagcgcgatattctggaccatgtggtaacgctcaacgccgataagctgatcgcc
gtagaccagacgctgattccgaccggcgaactgaagcctgtagcgggcactccgttcgat
ttcctcaagccatcggttgtggggtcgcgcatcaacgattcgacggatacccagattaaa
tacggcggtggctatgaccacggctgggtgctgaacggttccggtgattcactgaaactg
gccgctaccgtttacgaacccacatcgggccgggttatggaagtacgcacaacggagccc
gccatacaattctataccggcaattttctggatggcagcgttaccggccgggaaggattt
ccgtacaaaaaacggtacgccctctgcctggaaacggaacactaccccgattcgccaaac
catccggctttcccaactacagagctgaaacccggtcagacgtacaaaagcacaaccatc
tatcagttctcgacaaagaagtaa

DBGET integrated database retrieval system