KEGG   Spirosoma linguale: Slin_1285Help
Entry
Slin_1285         CDS       T01156                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sli  Spirosoma linguale
Pathway
sli00511  Other glycan degradation
sli00520  Amino sugar and nucleotide sugar metabolism
sli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Slin_1285
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Slin_1285
Enzymes [BR:sli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Slin_1285
Chaperones and folding catalysts [BR:sli03110]
 Intramolecular chaperones
  Others
   Slin_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX_C Glyco_hydro_20b CHB_HEX_C_1 CHB_HEX Fn3_assoc
Motif
Other DBs
NCBI-GeneID: 8725018
NCBI-ProteinID: ADB37335
UniProt: D2QLX9
Position
complement(1578696..1581254)
Genome map
AA seq 852 aa AA seqDB search
MRTRSLSLLILCVSLLFSCSKSPDADKSESAIADEAPKRLKVSLELVDNNYQNQARSRSV
LTLTNTGDEDLPATGWKLFFNGGTPAPFDSAVANVTLFNGDLHYISPGPTFKALPPGQST
RLEVLAGKIRNKTDFPGGFYLVLDKDPEQAFPVEVAINSGKIFEKSDRSLAETLFTENQK
IQAIPEDQLPTVFPTPVSYQKQGTPFVLTDQVVIAAEKEFKPEAEFLATALTPILGTKLV
LQEQGSGKAIFLQQKAGLGAEAYELTVNQDGIRLAATTRAGMFYGIQSLQTLIPAPALSG
KTGPVTIPGVVVADAPRFAYRALMVDIARNFQPKAEILKVLDVMALYKLNTFHFHFSEDE
GWRVEMPSLPELTEVGAKRAHTTDERKNLIPSYGSGPSTSNTSGTGFYSKADFVEILKYA
RDRHIDVIPEIESPGHARAAIKAMDARYEKLLKAGNKAEAERYLLRDVADKSVYRSVQGW
NDNVINVSLPSTYTFMERVVDDLRAMYKEADAPLKTIHFGGDEVPEGVWQKSPAVQKLMA
GNSAVKTTDDLWYYYFGKINQIVKSRGLFLSGWEEIGLKKVTQNGKVTWVPNKAFSSENF
RVNVWKNSPGSGAEDLAYRMANAGYKVILTGVTHMYLDLAYNPSSEEPGQYWGGYVDIDK
PFSFIPYNYLRNLKDDFTRKRIAPSLIKSREAITEAGKANLVGIEAPLWSETNRTPQQFE
YKLLPKLLAVAERAWAKDPAWAREKDDAKSDQLYNQAWSEFVHVVGKREFPRLDVFAGGY
QYRIPAVGAKVSNGKVAANVQFPGLIIRYTTDGTEPTAKSAVYREPVAQTGTVKFKAFTA
AGRAGQTVTITK
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgcgttccctctctctcctgattttatgtgtatccctgcttttcagttgctcg
aagtctcctgatgcagataaatcggagtcggcgattgctgatgaagcacccaaacggttg
aaagtttcgctggagcttgttgataataattaccaaaaccaggctcgttcacgatcagta
ctgactcttacaaacacgggtgatgaagacctcccggctaccggctggaagttgtttttt
aatgggggaacgcccgcccctttcgattctgcggtggcgaatgtaaccctgttcaatggc
gatttacattacataagccccggccctactttcaaagcactccctcccggacaatcaacc
agactggaggttttagcaggaaagattcgtaacaagactgacttcccgggtgggttctac
ctcgttctggacaaagacccggagcaggcctttccggtcgaagtagccatcaattccggt
aaaatcttcgagaaatcggatcgtagcctggccgagacgctattcacagaaaaccagaaa
atacaggccattccagaggatcagttaccaactgtgtttccaacgcccgtttcgtatcag
aagcagggaacaccttttgttctgaccgatcaggtggtcattgccgccgaaaaagaattc
aaacccgaagccgagtttctggcaactgctttaacgccgattttaggcactaagctagtt
cttcaggagcagggttccggaaaagccatcttccttcagcagaaagccgggctcggtgcc
gaagcgtatgaattaacggttaatcaggacggcattcgtctggcagcaactacgcgggca
ggtatgttttacggcattcagtcactacaaacgctgataccagcgcccgctctcagcggc
aaaacagggcctgttaccattccgggggttgtagtagccgatgcaccccgctttgcctac
cgagctttgatggtagacatagcccgaaatttccagcctaaagccgagattcttaaagta
ctggacgtcatggctctgtacaaactgaacacctttcatttccacttcagtgaagacgaa
ggttggcgggttgaaatgccttctctgcccgaactgaccgaggttggggccaaacgggcg
cacacaaccgacgagcggaagaacctgatcccctcctatggctccggcccgtcgaccagc
aacacatcaggaaccggtttctatagtaaagccgacttcgtagaaattctgaaatacgcc
cgtgaccggcatattgacgtgattccggaaatagaatcgccgggacacgcacgagctgcc
ataaaagcgatggatgcccgctatgaaaaactactgaaagcaggaaacaaggccgaagcc
gagcgttacttattgcgagatgtggccgataaatcggtctatcggtcggtacagggctgg
aatgacaacgttatcaatgtttcgttaccgtcaacgtatacgtttatggaacgggtagtc
gacgatttgcgggctatgtataaagaagcagatgctccattgaaaaccatccattttggt
ggcgatgaagttccggaaggcgtctggcagaaatcgcctgctgtacagaagctaatggcg
ggcaattcggccgtaaaaacgaccgacgatttatggtattactatttcggaaaaatcaac
cagatagtaaaaagccgtggtctgtttttgtcgggctgggaagaaattggtttgaaaaag
gttactcaaaatggcaaagtcacctgggttccgaacaaagcgttttcctctgaaaacttc
cgggtcaatgtctggaaaaacagtccgggttccggggcggaagaccttgcctatcgaatg
gccaacgccggttataaagtcattctgaccggcgtgacccacatgtatctggaccttgcc
tacaacccttcatccgaagagccaggccagtactggggcggatatgtcgatatagacaag
cccttttcttttattccatacaattacctgagaaatctcaaagatgatttcacccggaaa
cggattgctccatctctaatcaaaagcagggaagctatcaccgaagccgggaaggcaaat
ctggtcggtattgaggctcccctctggtcagaaacaaaccgaacgccccagcaattcgaa
tacaaacttctgccaaaattgctcgccgttgccgaacgggcctgggccaaagatcctgcc
tgggcacgtgaaaaagacgatgccaaaagcgatcagctctacaaccaggcctggtctgaa
ttcgtacatgttgtcgggaaacgggagtttccgcgcctggacgtttttgccggtgggtat
caataccggattcctgccgtgggcgctaaagtcagtaatggaaaagtagccgctaacgtc
cagtttccggggctgattattcgctatactaccgatggaacggagcctaccgccaaaagt
gcggtttacagggaacccgttgcccaaaccggcaccgttaaatttaaagccttcacagcc
gctggccgcgctgggcaaacggtgacaataactaagtaa

DBGET integrated database retrieval system