KEGG   Spirosoma linguale: Slin_1356Help
Entry
Slin_1356         CDS       T01156                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sli  Spirosoma linguale
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slin_1356
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slin_1356
  Amino acid metabolism
   00310 Lysine degradation
    Slin_1356
Enzymes [BR:sli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Slin_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1651110..1652612)
Genome map
AA seq 500 aa AA seqDB search
MALIDMVMPKMGESIMECTVIAWLKQPGDRIEADESVLEVATDKVDTEVPASNSGILKEI
LVKEGDVVAVGASIARIETDAAVETETVPKQSAPNESSPATVDQTPMGVGDVANVPVPQP
DLMPEPEVTTAAYELETSIAALSSRSAPMEKAVATSAKTLAGDTPIFNDRFYSPLVLNIA
KEENVSRDELDRIPGSGAENRVTKKDILAYVIDRAEGRAPSVTGNSQQSAQGVSSAVPQV
QLPHPVPSSAVPKPTGSQSNGSVNGQADIIQMDRMRKMIAQRMVESKQISPHVSSFVEAD
LTPVVQWRTRMKDLFKQQTGENLTYTPILVDAIVKAIKDFPMINVSVEGDTILVKKSINI
GMAVALPSGNLIVPVIHNADQYNLVGLTKKVNDLTKRARENKLTADDLVGGTYTISNIGT
FGNLMGTPIILQPQVAIMAFGAIVKKPAVIETAEGDFIGIRQLMFLSHSYDHRVVDGSLG
GQFVRRVADYLEKFDINLKL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggctctcatcgacatggttatgcccaaaatgggcgaaagtataatggaatgtacggta
attgcctggctcaagcagccaggcgaccgtattgaggctgatgaatccgtactggaagta
gctaccgataaagtggatacggaagtaccagcctcgaacagtggcattttgaaggaaatt
ctggttaaagagggtgacgtcgttgcggtgggtgcatccatagcccgcattgaaacggac
gctgctgtcgaaacggagacggtcccgaaacaatcggcgccaaatgagtcgtcaccggct
actgttgaccagacacctatgggcgtgggtgatgttgccaacgtgccagttcctcaaccc
gatttgatgcctgagccggaagtcactacggccgcctatgaactggaaacgagcattgcc
gccctgagcagccgctccgctcctatggagaaggcggtggctacatcagccaaaacgtta
gcaggcgacacgccgattttcaacgaccgcttctactcacccctagtgctgaatattgca
aaggaagagaacgtttcgcgcgatgagctcgaccgtattccgggatcgggtgccgaaaat
cgggttacgaagaaagatatactcgcttacgttatcgaccgcgccgagggtcgggcacct
tctgtaaccggtaatagtcaacagtccgcacagggtgtttcgtccgccgttcctcaagtg
cagctacctcatcccgtgccatcatcggctgtgccaaaaccaacgggcagccagtcgaac
ggctccgtaaacggacaggctgacattattcagatggaccgcatgcggaaaatgattgcc
cagcggatggtggaatcgaagcagatttcaccacacgtcagttcattcgttgaagccgat
ctgacgcccgttgtgcagtggcgaacccgcatgaaggatctgtttaagcagcaaaccggc
gaaaatcttacgtataccccgattctggtcgacgctatcgtgaaggcaatcaaagacttc
ccaatgatcaacgtgtctgttgaaggtgataccattctggtgaaaaagtcgatcaatatt
ggcatggcggtggctttaccgagtggcaatctgatcgtgccggtcattcataatgccgac
cagtataatcttgttggtttgactaaaaaagtcaatgacctgactaaacgggctcgtgaa
aacaaactgacagccgacgatctggtgggtggtacttacacgatttctaatatcggcaca
ttcggcaacctgatgggtacacccatcattctgcaaccgcaggtagccattatggccttt
ggtgccatcgtgaagaaacccgctgtaattgaaacggccgagggcgactttatcggaata
cggcagttgatgttcctgtctcactcctacgaccaccgcgtagtcgatggctcgctgggc
ggtcagtttgttcgtcgcgtggctgattatttagagaaatttgatataaaccttaaactc
tga

DBGET integrated database retrieval system