KEGG   Spirosoma linguale: Slin_1600Help
Entry
Slin_1600         CDS       T01156                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sli  Spirosoma linguale
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sli03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928881..1929492
Genome map
AA seq 203 aa AA seqDB search
MEYPSKLIEDAVNEVSKLPGIGKKTALRLVLHLLKRDEEQTETLAQSLTAMRTNVKYCRK
CHNLSDNEVCTICASNKRDQSLICVVEDTRDVLAIENTAQYRGLYHVLGGIISPVEGIGP
SDLQIDSLMNRLRDAGSEQVREIILAISPTMEGDTTAFYLQKKLKPFNLKISTIARGVPI
GGDLEYADEVTLGRSILSRIAYD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttggaatacccatccaaactcatagaagacgcggtgaacgaggtgtcgaaactgccgggt
atcgggaaaaaaaccgctctccggctggtgctgcatctgcttaaacgcgatgaagaacaa
accgaaacgctggcccagagtttgacggccatgcgtaccaatgtgaagtactgtcgtaaa
tgccataacctctcggataatgaggtatgcaccatatgcgccagtaacaaacgtgaccag
tccctgatttgtgtggtagaagatacccgcgatgtattagcgattgaaaatacagcccag
tatcgtggcctatatcatgtgctgggtggtattatctcacccgtagaaggcattggcccc
agcgatttgcagatcgactcccttatgaaccgcctgcgcgatgccggaagcgaacaagtg
cgcgaaatcattctggcgatcagtcctacgatggaaggagacacaacggcgttctatctt
cagaagaaacttaagccgttcaatctcaaaatttcaaccattgcccgcggagttcctatc
gggggcgaccttgagtatgccgatgaggtgacactgggccgcagcattctgagtcggatt
gcctacgattaa

DBGET integrated database retrieval system