KEGG   Spirosoma linguale: Slin_1600Help
Entry
Slin_1600         CDS       T01156                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sli  Spirosoma linguale
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Slin_1600
DNA repair and recombination proteins [BR:sli03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Slin_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928881..1929492
Genome map
AA seq 203 aa AA seqDB search
MEYPSKLIEDAVNEVSKLPGIGKKTALRLVLHLLKRDEEQTETLAQSLTAMRTNVKYCRK
CHNLSDNEVCTICASNKRDQSLICVVEDTRDVLAIENTAQYRGLYHVLGGIISPVEGIGP
SDLQIDSLMNRLRDAGSEQVREIILAISPTMEGDTTAFYLQKKLKPFNLKISTIARGVPI
GGDLEYADEVTLGRSILSRIAYD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttggaatacccatccaaactcatagaagacgcggtgaacgaggtgtcgaaactgccgggt
atcgggaaaaaaaccgctctccggctggtgctgcatctgcttaaacgcgatgaagaacaa
accgaaacgctggcccagagtttgacggccatgcgtaccaatgtgaagtactgtcgtaaa
tgccataacctctcggataatgaggtatgcaccatatgcgccagtaacaaacgtgaccag
tccctgatttgtgtggtagaagatacccgcgatgtattagcgattgaaaatacagcccag
tatcgtggcctatatcatgtgctgggtggtattatctcacccgtagaaggcattggcccc
agcgatttgcagatcgactcccttatgaaccgcctgcgcgatgccggaagcgaacaagtg
cgcgaaatcattctggcgatcagtcctacgatggaaggagacacaacggcgttctatctt
cagaagaaacttaagccgttcaatctcaaaatttcaaccattgcccgcggagttcctatc
gggggcgaccttgagtatgccgatgaggtgacactgggccgcagcattctgagtcggatt
gcctacgattaa

DBGET integrated database retrieval system