KEGG   Spirosoma linguale: Slin_1719Help
Entry
Slin_1719         CDS       T01156                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sli  Spirosoma linguale
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sli00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sli00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sli00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2064571..2067339)
Genome map
AA seq 922 aa AA seqDB search
MQALSTRKFNSRLLLCALLLSMAWTTAKAQAAKTSSRAASGSPFGKERIKLNEGWRFMRY
TMEPDKLIYDVRPPIQDTNDSKVADSKPTEAVQVDKKEEVLKTWILPSGNDFINDPVKRH
TRPVGDPGADFPFVKATFADEAWEAVTLPHDWAIKGPFYAGDRPEVGGGMGRLPSHGVAW
YRNKIAVSAADRGKIIYLDIDGAMSHAMVWLNGHLVGGWPYGYNSFRLELTPHLNFGGIN
QLAIRVDNPNYSARWYPGGGLYRNVWLTKVAPVHVAQWGTFVTTPAVSATEAIINVSVQI
ENKGKTEQTVDVKTQIYALNTYSKPTGASLASLPTQKITVKTGDHQPIEGKVTIKKPKLW
GPYPTQKPNLYVARTSVFVGGRQVDQFETPFGIRQVKFNSTKGLLVNGQPVRIQGVNQHH
DLGALGAAFNVRAAERQLERLRELGCNAIRMAHNPPAPELLDLTDRMGFLVIDEIFDSWE
RRKTPHDFHLIFPDWHEPDTRAFIRRDRNHPSVIAWSFGNEVGEQYTDTAGAAIARKLHD
IVHEEDPTRPASASQNYAKPDMPFTKVMDFLSLNYQGEGIRDAPAYAHLKGIRTSPLYPA
FQKAFPDKLIISSETASALSTRGSYTFPVATENSAPVSDGVGGNPVTKEVSGYELYTAQF
GASPDKVFATQDRHPYVAGEFVWTGWDYLGEPTPYYSARSSYSGIIDLAGFKKDRFYLYQ
SRWRPDLPIAHILPHWNWPNRVGEVTPVHVFTSGDEAELFLNGQSLGRKKKAEYAYRLRW
DDVQYKPGELTVITYKNGKRWAEERIRTTDKPAALVAQADRSAIQANGEDLAFVTVTVTD
KNGLMVPDANNTVSFSLQGPGEIVATDNGDPANLTSFSSHERQAYNGMVLAIIRAKKGAP
GKLTLTIKAEGLAKTQLNIRSN
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctctttcaacccggaaattcaattcccgtcttctcctttgcgcgttactgctt
agtatggcatggacgaccgctaaggcacaagctgcaaaaactagttctagagcagcatcc
ggttctcccttcggtaaggaacgtataaagctcaacgaaggctggcggtttatgcgctat
acgatggagcctgataaactgatctatgacgttcggccacccatacaggataccaacgac
agcaaagtagccgactcaaaacctacagaagccgtacaggtagacaaaaaggaggaagtt
ctgaaaacctggattctaccttcgggaaatgactttatcaacgaccccgtcaaacgccat
acacgacccgtcggcgatcccggagccgatttcccgttcgtgaaagcgaccttcgccgac
gaggcctgggaggctgtaaccttaccccacgactgggctattaaaggacctttttacgct
ggcgaccgacccgaagtgggcggaggaatgggccgattacccagccacggggtagcctgg
taccggaacaagatagccgtttcggccgcagaccggggtaaaattatttatctggacatc
gacggagccatgtcgcacgctatggtttggctcaacggccatttggtaggtggctggcct
tacggctataattcctttcggctggaactaacgccacacctaaattttggaggcataaat
caactggcgattcgggttgataacccaaattactcggccagatggtatcccggtggaggg
ctgtatcgtaacgtgtggctaaccaaagtagccccggtgcatgtggcgcagtggggaacg
tttgtgacaacccccgccgtttcggcaaccgaagcgatcatcaacgtatccgtgcagatt
gaaaacaaaggaaaaacggagcagaccgttgacgtaaaaacccaaatttatgcgctgaat
acgtactcaaaaccaactggagcttctctggcctcgttgcccacccaaaaaattacggta
aagacgggcgaccatcaaccgatagagggtaaagtgacaatcaaaaaaccaaagctatgg
ggcccctacccgacgcagaaacccaacctgtatgtagcccgtacaagcgtttttgttggc
ggtcgacaggttgaccaatttgagaccccgtttggcattcgccaggtgaaattcaattca
acaaaaggattgctggtcaatgggcagccggttcgtatacagggcgtgaaccagcaccac
gacctgggtgccctgggagctgcatttaacgttcgtgccgccgaacgccagctcgaacgg
ctgcgtgagctgggttgcaatgccatccgaatggcccacaatccacccgcccccgaactc
ctcgacctgaccgaccgcatgggctttctggtcatcgatgagatttttgatagctgggag
cgccggaaaacaccccacgattttcacctgattttccccgactggcacgagccggacacg
cgggcgtttattcgacgtgaccggaatcacccgtccgttatcgcctggagttttggcaac
gaagtaggcgagcagtataccgacaccgccggagcagccattgcgcgaaaactgcacgac
atcgtacacgaagaagatcccacccgcccagcctcagcttcgcagaattacgccaagccg
gatatgccgttcacgaaggtgatggattttttgagtcttaattatcagggtgagggcatc
cgggatgcaccggcttatgcgcatttgaaaggcattcgaacctcaccgctttaccctgcc
tttcagaaagcgtttcccgacaaacttattatcagcagcgaaacagcctcagccctaagc
acccgtggttcttatacatttccggtcgcgacggaaaactccgcccccgtaagcgacggc
gtgggtggtaaccctgtcaccaaagaagtgagtggctatgagttgtacacggcccagttt
ggcgcttcgccggataaagttttcgcgacccaggaccgccacccgtacgtagccggtgaa
ttcgtctggacgggctgggattatctcggtgagccgacaccctattactcggcccgaagt
tcctattcgggtattattgatctggcggggttcaaaaaagatcgtttctatctgtaccag
tcccgctggcgaccggatttgccaattgcccacattctgccccactggaactggccaaac
cgagtcggggaagttactccggtgcatgtgttcacgtcgggcgatgaagccgaactgttc
ctgaacggccagtcgctgggccggaaaaagaaagccgaatatgcgtatcggctccggtgg
gacgacgtgcagtacaaacccggcgaactcaccgtcatcacgtataaaaatggaaaaagg
tgggctgaagaacgtataagaacgaccgataaacccgcagcgctggtggctcaggcagac
cgatcagccatacaggccaatggtgaagacctggcatttgtgacggttaccgtcaccgac
aagaatggcctgatggtgcccgacgccaacaatactgtgagttttagtttacagggaccg
ggcgaaatcgtagccaccgacaacggcgatccggcgaatctgacttcattttcttcacat
gagcgtcaggcctacaacggcatggtgctggccatcatacgagcgaaaaaaggtgccccc
ggcaaattgaccctaacaatcaaagccgagggtttggccaaaacccaactgaacatccga
agtaattga

DBGET integrated database retrieval system