KEGG   Spirosoma linguale: Slin_1784Help
Entry
Slin_1784         CDS       T01156                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sli  Spirosoma linguale
Pathway
sli00340  Histidine metabolism
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01230  Biosynthesis of amino acids
Module
sli_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Slin_1784
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Slin_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 8725521
NCBI-ProteinID: ADB37829
UniProt: D2QQX7
Position
2156786..2158075
Genome map
AA seq 429 aa AA seqDB search
MNIIPFPDRAEWPALLARPVQSTQQIEAVVAPILAQVRAGGDAALVELAQKFDKVDLSAE
GMEVPASELDAAERQLSDTLKEAIRQAYQNIRLFHERQKQPIEKVETMPGVVCWRKSVGI
EKVGLYIPGGTAPLFSTVLMLGIPAQLAGCREVVLCTPSNHPAIYFAAKLVGITKVFRIG
GAQAIAAMAYGTESVPQVYKIFGPGNQYVTAAKMLVAKEGMAIDMPAGPSEVAVYADDSA
VPSFVAADLLSQAEHGADSQVLLVSTSKKLVSMVNLVLPTQLSKLPRRELAAKALENSKA
ILVDTEADAIDLLNAYAAEHLILSVENAEAVAEKIINAGSIFLGNYTPESAGDYASGTNH
TLPTNGFARAYSGVSLDSFVKKITIQHITPEGIQNLGPVVEAMAEAESLDAHKRAVSLRM
ASLSEVNPV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcatcccttttcccgaccgtgctgaatggcctgcgctgctggctcgcccggtg
cagtcgacacaacagattgaagcggtagtagcgcctattcttgctcaggttcgtgccggg
ggcgatgccgctttggttgaactggctcagaagtttgataaagtcgacctgtcggcggag
gggatggaggtgcctgcttcggaactcgatgccgccgaacgtcaactgagtgatacgcta
aaggaggccatccggcaggcctaccagaacatccggctttttcacgagcggcaaaagcag
cccattgaaaaagttgaaaccatgccgggggtcgtatgctggcgtaaaagcgttggcatc
gaaaaagtagggctgtacataccgggcggcactgcgcccctgttcagcacggtgctcatg
ctgggcattccggcccagttggcaggttgccgcgaggtagttctttgtacgcccagcaac
cacccggccatttactttgcagccaaactcgttggtatcacgaaggtatttcggattggg
ggtgctcaggccattgcagccatggcctacggaacggaatcggttccgcaggtctacaag
atttttggtcccggtaaccaatacgtaacggcggccaagatgctggttgccaaagaaggt
atggccatcgacatgcccgccggacccagcgaagtggccgtgtatgccgatgattcagcg
gtgccgtcgtttgttgccgccgacttgctctcgcaggccgaacacggtgctgacagccag
gtactgctggtatcgaccagtaaaaaactagtgtcgatggtcaatctggtactgcccacg
caattgagcaagctcccccgtcgcgaactggctgccaaagcccttgagaacagcaaggca
attctggtcgatacggaagcggatgccattgacctgttaaacgcttatgcagccgaacac
ctgattctgagcgtcgaaaatgccgaagccgtcgcggagaaaattattaatgcaggctct
atttttctgggcaactacacgcctgaatcggccggcgattacgcgtcgggtaccaaccat
accttgccaacaaacggatttgcaagggcctacagtggggtatcgctggatagtttcgtg
aagaagatcaccattcagcacatcacgccggaaggtatccaaaacctcgggccggttgtg
gaagccatggccgaagctgaatcgctcgacgcccacaaacgcgccgtcagcctgcgaatg
gcaagcctgagcgaagttaatccggtctga

DBGET integrated database retrieval system