KEGG   Spirosoma linguale: Slin_1907Help
Entry
Slin_1907         CDS       T01156                                 

Definition
glycoside hydrolase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sli  Spirosoma linguale
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Slin_1907
  Lipid metabolism
   00561 Glycerolipid metabolism
    Slin_1907
   00600 Sphingolipid metabolism
    Slin_1907
Enzymes [BR:sli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Slin_1907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2306625..2308817)
Genome map
AA seq 730 aa AA seqDB search
MKQLCLSVLFVFFITLITKAAPGDVHIAIETRQTALVIRVDKDQSPTLVHLGSKLRNAAE
YAAIPARGKRGEDYTDIYNSVYTPAGSRNLLEPAIQVTHADGNPSLDLKYIRHESQSMAD
GVVLTKVYLKDPQYPFEVTLYYKAYQNEDVIEQWSTIRHTEKKSITLHKYASANLYIPAQ
NYYLTHFHGDWANEMNPSEIPLTEGIKILDSKLGTRADLFQPPSFLVSLNKPAEEEQGEV
IAGTLSWSGNYQLAFEVDPLHNLRIIPGINPYASAYSLAPGTEFTTPAFLFTYSDKGKGG
ASRSLHRWARKHRIPQGEGNRLTLLNNWEATYFDFNEEKLSALFKDGKKLGVDLFLLDDG
WFGNKYPRNNDRAGLGDWQENVKKLPHGLGYLVKEAENAGIKFGIWLEPEMVSPKSELYE
KHPDWVIKLANRSEYYFRNQLVLDLSNPKVQDFVYGVVNDLMTKNPTLGFIKWDCNAVIY
NAFSATIQNQSNLYVDYVQGLYKVLDRLRAKYPTLPMMLCSGGGGRVDYGALKYFTEYWP
SDNTDAQERIFIQWNYSYFFPSIASCNHVTDWGKQPIKFRTDVAMMGKLGYDIVVSKLTE
EELTFSQQALKTYEGIKNIIWKGDLYRLASPYTNDVASSMYVSESRDRAVWFTYLVNSRY
KAGSQAPIKLNGLDPAKNYRIRELNVYPGTTSRINTSTTTYSGNYLMAIGFNPQVDTRRT
SVVLEVNEVK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctttgcctgtcggtactttttgtttttttcataaccttaattacaaaagcc
gcgccgggcgatgtgcacattgccattgaaacccggcaaacggctctggtaattcgggtc
gataaagaccagagcccaacgttggtccatctgggatcaaaacttcgaaacgcggccgaa
tacgcagccattccggctcgtggcaaacggggtgaagattataccgatatctacaattca
gtctatacgcccgctggaagccgtaacttgctggagcctgctattcaggttacccatgcc
gatggaaacccttccctcgacctgaaatacattaggcatgaaagccagtcgatggccgat
ggcgttgtgctaacgaaagtgtacctgaaagacccacagtacccttttgaggttacactg
tactacaaagcctaccagaatgaagatgttatcgagcagtggagcaccattcgccatacc
gaaaagaagtcgataacgctccataaatatgcttcagcgaacctatatatcccggcccag
aactattacctgacgcattttcacggcgactgggccaatgagatgaaccccagtgaaata
ccgcttactgaaggtatcaagatattggattctaaactaggaacccgcgccgacctgttt
cagccgccctcatttctggtatcgctgaataaacccgctgaagaagagcaaggcgaagtc
attgccggtacactttcctggtcggggaattatcaactggcatttgaggtcgacccgttg
cataacctccggatcataccgggcattaatccgtatgcatcagcgtactcgctggcgccc
ggaaccgagttcacgacacccgctttcctgtttacgtactccgacaaaggtaaaggcggg
gcaagccgcagcttgcatcgatgggcgcgtaaacaccgcattccgcaaggcgaaggcaac
cgcctgacgctgctgaacaactgggaagctacttattttgactttaacgaagagaaatta
agtgccctgttcaaggatggcaaaaaactcggtgttgacctgtttctgctggatgacggc
tggttcgggaataagtacccgcgaaacaacgaccgggccgggttaggcgattggcaggaa
aatgtcaaaaaactaccgcatggcctgggctatctggttaaggaggccgaaaatgcaggt
atcaaatttggtatctggctcgaaccggagatggtgagccccaaaagtgaactgtatgaa
aaacaccccgactgggtgatcaaactagccaatcggtcggagtattacttccgcaatcaa
ttggtccttgatttatcgaatccgaaagttcaggattttgtctatggagtcgtgaatgac
ctaatgaccaaaaatccgacgctgggattcattaagtgggattgtaatgccgtgatctat
aacgcgttctcggccaccattcagaaccagtcgaacctttatgtcgattacgtgcaaggc
ctttataaagtacttgaccgactacgggcgaagtatcctaccctgcccatgatgctttgc
tcgggtggtggcggccgggtagattatggcgcgctgaagtacttcaccgaatactggccg
agcgacaacaccgacgcccaggaacggatatttatccagtggaattactcgtatttcttc
ccatccattgccagttgcaaccacgtgacagattgggggaaacagcccataaagttccgc
acggacgtagccatgatgggcaagctggggtacgatattgtggtgagtaaactgactgaa
gaagaattgacattcagccagcaggccctgaagacctacgagggcattaaaaacataatc
tggaaaggcgacttgtaccggctcgcttcgccctacacgaatgatgtcgcttcttccatg
tacgttagcgagtcgcgcgaccgggcggtctggttcacctatttagtcaattcacgctac
aaagcggggagtcaggcacccatcaaactgaatggcctcgatcctgccaaaaactaccgc
attcgggaattgaacgtttatccgggaactacctcccgaatcaataccagtacaacaacg
tactccgggaactacctgatggccattggcttcaatccgcaggtagacacccgccgaacc
agcgtggtgctggaggtgaacgaagtaaaataa

DBGET integrated database retrieval system