KEGG   Spirosoma linguale: Slin_2261Help
Entry
Slin_2261         CDS       T01156                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sli  Spirosoma linguale
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Slin_2261
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Slin_2261
Enzymes [BR:sli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Slin_2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2740493..2742037)
Genome map
AA seq 514 aa AA seqDB search
MLVAIGIVILPVQFSRDAGICVFSIRQKPGMRLVVNSLMQRFKPPGWFSLSLLLSICGLA
AAQSPVKSGNAGQVEFWLTDPVHAVLFKKQTPLVFRDGVVKAELPTTIRVDETKTYQPID
GFGYTLTGGSAQLIDQMEATARTALLTELFSTAGKGIGVSYLRISIGASDLDERVFSYDD
LPVGATDPTLAKFSLAPDEQHLIPVLKQILAINPAIKILGSPWSPPVWMKSNGNAKGGSL
KLEYYDVYAQYFVRYIQGMKKAGIPIDAITIQNEPLHPGNNPSLLMLPAEQALFIRKSLG
PAFKKAGLKTKIILYDHNADRPNYPLSVLADPEARKYVDGSAFHLYGGPISALSEVHKAY
PDKNIYFTEQWIGAPGNLKGDLNWHVRELIIGATRNWSRTVLEWNLAADPEQKPHTPGGC
DQCLGALTIRGNTVKRNPAYYIVALAAKFVRPGSVRIESNLPASLPNVAFKTPDGKTVVI
ALNDSPSAQPVRIISKDRHAQFTLASGAVGTLVW
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttggtagccatcggcattgtcattttgccggttcaattcagtagagacgcgggcata
tgtgtcttttcgatcagacaaaagcccgggatgcggctcgttgtcaactcgcttatgcaa
cgatttaaaccgcctggctggttttctctcagcctgcttctgtccatttgtgggcttgct
gctgcccaatcgcccgtaaaatcgggtaacgcagggcaagtcgaattctggctgacagac
cctgttcatgctgttttgtttaagaagcagactccgcttgtcttccgggatggtgtggtc
aaagcggagttgccaaccacaattcgagtagacgagactaaaacctatcagcctattgat
gggttcgggtataccttaacggggggtagtgcacaactgatcgatcagatggaagctacg
gcccggacggccctgctcaccgaacttttttcgacggctgggaaagggattggggtcagt
tatttgcggataagcatcggcgcgtcggatctggatgaacgcgtgttttcgtatgacgat
ctgccagtgggagcaacggacccaaccctggctaaatttagtttggctcccgatgagcag
catctgattccggttctgaaacagattcttgcaattaaccccgcgatcaaaatccttggt
tcgccctggtcgccacccgtctggatgaaatctaacggaaacgcaaaggggggaagtctg
aaactagaatactacgatgtttacgcgcagtattttgtccggtacattcagggcatgaag
aaggcgggtattccaattgacgcgattactatccagaatgagccactacatccgggcaat
aaccccagtctgttaatgctacctgccgaacaggcgcttttcattcggaaaagcctgggt
ccggcgtttaaaaaagccggacttaaaactaaaattattctttacgatcataatgcggat
cggcccaactaccccctgtcggtattggctgatccggaggctcgaaaatacgttgatgga
tcggcgtttcatttgtacggtggcccgatcagtgccctctcagaggtgcataaagcgtat
cctgacaagaatatttatttcaccgaacagtggatcggtgcgccgggcaatctgaaaggt
gacctgaactggcatgtccgggagctgatcatcggggctacccgcaactggagccgtacc
gtactggaatggaatctggccgctgatccagaacaaaagccgcatacacccggcggatgc
gatcaatgcctgggtgcgttgaccatcaggggaaataccgtaaagcgcaacccggcctat
tacattgttgcactggcggcaaagtttgtccggccgggttctgttcgcattgagtctaac
ctgcctgcgtctctgcccaacgttgcgtttaaaacacctgacggaaaaacagttgtgatc
gcgctgaacgatagtccatccgcgcagcccgttcgtattattagtaaggacagacacgcc
cagtttacgctggccagcggtgctgtaggaaccctggtctggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system