KEGG   Spirosoma linguale: Slin_2428Help
Entry
Slin_2428         CDS       T01156                                 

Definition
Di-heme cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sli  Spirosoma linguale
Brite
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Slin_2428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2931093..2932169)
Genome map
AA seq 358 aa AA seqDB search
MSFKDVNLSFMKKLLFILAISVLVLQGCSKPSESPDASVPTGSARPELASYNYLVELPAH
IQQALITVDNSPATNPITNNGATLGRVLFYDKNLSLNRTVSCGSCHKQAAAFDDDVALSK
GFANARTTRNSMSLLNIRFYKSGRMFWDERVPTVEKQALQPIQNPLEMGLTLTELESRVK
SLTYYPDLFQKAFGSPVIDSVRIAKALAQFERSIVSYQSKYDKVKQGLETFTAAESRGEQ
IFLTAPNPGPGGGGIACAGCHTPPMFITSTPAGGFAFPLESGINGQNRFKSGSLRNIATR
KFLFHAGTIADLNAMFTGPQPVPAHGVPPQDVAAMIAFLNTLTDTAITQDPKYSDPFR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttaaggatgtaaacctatcattcatgaaaaagctactgttcattctcgccata
tccgtactggtcctgcaaggttgttccaaaccgagtgagtctccggatgcatccgtgccg
actggttctgcccgacccgaactggcttcgtacaattatctggttgagctaccagcgcat
attcaacaggctctgataactgtagacaatagcccggcaactaatccaataacgaataat
ggcgctacgctgggacgggttctgttttatgataaaaacctgtctctgaatcggacggtt
agctgcggcagctgtcataagcaagccgctgcttttgatgatgatgtggcattaagtaaa
gggtttgccaatgcccgaacaacgcgcaattcaatgtcattgctgaatatccgtttttac
aaatccgggcgaatgttctgggatgagcgcgtgcctaccgttgaaaaacaagcccttcag
cctattcagaatccgctggaaatgggcttgacgctgaccgagctcgaaagccgggtcaag
tcattgacctattatccggatttatttcagaaagcgtttggcagtccggtaatcgactct
gtacgaattgccaaagcattggcgcagtttgagcgatccatcgtttcctatcaatcgaaa
tacgacaaggtaaaacagggtttggaaaccttcacggctgccgaatcgcgtggcgagcag
atttttctgaccgcgcccaatccgggtccgggaggtgggggtattgcctgcgcgggttgc
cacacaccccccatgtttattacatcgacacccgccgggggatttgcctttccactggaa
tcgggcatcaatggccaaaatcgatttaaaagcgggtcattgcggaacatcgccacccga
aagtttttattccacgcaggcacaatagccgatttaaatgccatgttcaccggtccacag
cctgtacctgcgcatggcgtccctccccaggatgtggctgccatgattgccttcctgaat
acactaaccgatacggccatcacccaggaccctaagtattccgatccgttccggtaa

DBGET integrated database retrieval system