KEGG   Spirosoma linguale: Slin_2596Help
Entry
Slin_2596         CDS       T01156                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sli  Spirosoma linguale
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Slin_2596
   00052 Galactose metabolism
    Slin_2596
   00500 Starch and sucrose metabolism
    Slin_2596
   00520 Amino sugar and nucleotide sugar metabolism
    Slin_2596
Enzymes [BR:sli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Slin_2596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3138319..3139278
Genome map
AA seq 319 aa AA seqDB search
MKIRKAVITAAARGERLYPVADTIQKAMLPVIDTDGLHKPVIQAIAEEAFLSGIEEICVV
CAPGDGERYINAFTSLRDNLVKSYKGVDWAREEAEKIDNLISRIQFTEQQEPLGYGHAVY
CAREFVNEEPFLLLLGDYLYVSNLTSKRCAAQLIELAMQEDCSVSAVNPTIEHQIGRYGT
LTGKHVANMSGVYQIEKLIEKPSLSVAELELQTPGLRVGYYLCFFGMHVLTPTVFSLLEK
QIEEGSKNVLLTPALQALADTEKYLALEVKGNRYDLSGRQGLLRAQMALGLAGVAHDETL
TSMVELLAEANTRKAQLAQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcagtaattacagcagccgctcgcggggaacgattatatccggta
gccgataccattcaaaaagccatgctccccgttattgatacggatggcttacacaaacca
gtcattcaggcgattgccgaggaggcttttctaagcggtattgaagaaatatgcgtcgtt
tgcgcccccggtgatggagaacgttatatcaatgccttcacatctttacgagataatctg
gtaaagtcgtacaaaggagtcgactgggcgcgggaagaagccgaaaaaattgacaacctc
atcagccgaattcagttcaccgagcagcaggagccacttggttatggacatgccgtttac
tgcgccagagaatttgtcaacgaagaaccttttctgctcctgctgggcgattatctgtac
gtctctaatctgaccagcaagcggtgtgccgcacagctgattgaactggcgatgcaggaa
gactgctccgtatcggcagttaacccaaccattgagcatcagatcggtcgttatggcacc
ctgaccggcaagcacgttgccaacatgagcggggtgtaccagattgaaaaactcatcgaa
aaaccgtcgctgagcgttgccgaacttgagctacagacgcccggtttacgtgtgggctac
tacctctgtttcttcggcatgcacgtgctaaccccgacggttttttccctgcttgagaag
cagatagaagaaggaagcaagaacgttctgttaactcccgccctccaggcactggccgat
acagaaaaatacctggcgctggaagttaaaggaaaccggtacgacttaagcggacgccag
ggcctgcttcgggcacaaatggcgctgggactggcgggagtggcccatgacgaaaccctg
acctctatggtagaactgctggccgaagccaataccagaaaggcacaattggctcaataa

DBGET integrated database retrieval system