KEGG   Spirosoma linguale: Slin_2894Help
Entry
Slin_2894         CDS       T01156                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sli  Spirosoma linguale
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slin_2894
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_2894
   00620 Pyruvate metabolism
    Slin_2894
   00640 Propanoate metabolism
    Slin_2894
  Energy metabolism
   00680 Methane metabolism
    Slin_2894
Enzymes [BR:sli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Slin_2894
Lipid biosynthesis proteins [BR:sli01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Slin_2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3495853..3497748
Genome map
AA seq 631 aa AA seqDB search
MRIRTFNEYQEAYKHSVEDPESFWAEIAQEFQWRKPWTKTLQWNFDEPNVKWFTGGKLNI
TENCLDRHLLTQGDQPAIIWEPNDPNEASITLTYRMLHDQVCRFANVLKRNGVVKGDRVC
IYMPMVPELAIAVLACARIGAVHSVVFGGFSAQSIADRINDAQCKVVVTADGAYRGNKEI
PLKSTVDDALIGCPSVRKVIVLTRTRTPVSMLKGRDIWWEQELKQVTADCPAEEMDAEDM
LFILYTSGSTGKPKGVVHTCGGYMVYAAYTFQNVFQYEPGDIHFCTADIGWITGHSYIVY
GPLACGATSIIFEGTPTYPDYGRFWDITDKHKVNILYTAPTAIRSLMGFGLDKVENHDLS
SLRVLGSVGEPINEEAWHWYDDHIGKNRCPIVDTWWQTETGGILISPLASITKTKPTYAT
LPLPGIQPILVDENGKEIEGNGVSGNLCMKFPWPGILRTTYGDHERCRQTYFATYPGLYF
TGDGCLRDEDGYYRITGRVDDVLNVSGHRIGTAEVENAINMHTGVVESAVVGYPHDIKGQ
GIYAYVITDQQPSDHDADLTKRDILATVTRVIGPIAKPDKIQFVTGLPKTRSGKIMRRIL
RKIAEGDTSNLGDTTTLLDPAVVDEIKEGAL
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccgaacctttaacgagtaccaggaagcctacaagcacagtgtagaagaccct
gaatctttctgggccgaaattgctcaggaatttcaatggcgtaaaccctggaccaaaaca
ctgcaatggaatttcgatgaacccaacgtgaagtggttcaccggaggcaaactcaacatt
acggaaaactgtctcgatcgtcacctgcttacccagggcgatcaacctgctattatctgg
gaacccaacgaccctaatgaagcaagtattaccctgacttaccggatgctccacgaccag
gtgtgccgattcgccaatgtgctgaaacgcaatggcgtagttaaaggcgaccgggtttgt
atttatatgccgatggtgcccgaactggctattgccgttctggcctgcgcccgtatcggg
gccgttcattcggtggtttttggcggtttttcggcacaaagtattgccgaccggattaat
gacgcccagtgcaaagtggtcgttacggccgatggagcttaccggggcaacaaggaaatt
ccgctcaaaagcacggtcgacgatgccctgatcggctgcccgagcgtacgaaaagtgatt
gttctgacccgtacccgtaccccggtatccatgcttaaaggccgcgacatctggtgggaa
caggagctaaagcaggtcaccgccgattgccctgccgaggaaatggacgccgaagatatg
ctcttcatcctctacacctccggctcaacgggcaagccaaaaggcgttgtgcacacctgt
ggtgggtacatggtctacgcagcctacacgttccagaatgtgttccagtacgagcccggc
gatattcacttctgcacggccgatattggctggattaccggacatagctacattgtatac
ggcccactggcctgcggagccacgtccataatttttgaaggaacgccgacctatccggat
tacggccgcttctgggacataacagacaaacataaagtcaacattctgtacacggcacca
acggccattcggtcgctgatgggcttcgggctggataaagtagaaaaccacgacctgagc
agcttacgggtgctcggttccgtgggcgaacccatcaacgaagaagcctggcactggtac
gacgatcatatcggtaaaaaccgatgccctattgtcgatacctggtggcagaccgaaacg
ggtggtattctgatttcacctttggccagtatcactaaaacaaaaccaacctacgcaacc
cttcccctgccgggtattcagccgattctggtcgatgaaaacggtaaggagatcgaagga
aacggtgtgagcggcaatctgtgcatgaagtttccgtggccgggcattttacggacgacc
tacggcgaccacgaacgctgccgacaaacgtattttgctacttatccgggtttgtatttt
acaggcgatggctgtctgcgcgatgaagatggctattaccggattacaggtcgcgtggat
gatgtactcaacgtatccgggcaccgcattggtacggccgaagtcgaaaacgccatcaac
atgcacacgggcgtggttgaaagcgcagtcgttggttacccgcacgacatcaaaggacag
ggtatctacgcctatgttatcaccgatcagcaaccgtccgaccacgacgccgacctgacc
aaacgggatattctggctacggtaacgcgggttatcggtccgattgccaagcccgataaa
attcagtttgtgacgggcctacccaaaacgcgttccggcaaaataatgcgccgtatcctc
cgtaaaatcgccgaaggcgacaccagtaatttgggcgatacgaccactctgctcgaccca
gcggtagttgacgagattaaggagggggcgctgtaa

DBGET integrated database retrieval system