KEGG   Spirosoma linguale: Slin_3103Help
Entry
Slin_3103         CDS       T01156                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sli  Spirosoma linguale
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sli00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Slin_3103
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Slin_3103
Enzymes [BR:sli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Slin_3103
Two-component system [BR:sli02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Slin_3103
Bacterial motility proteins [BR:sli02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Slin_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3766555..3767589
Genome map
AA seq 344 aa AA seqDB search
MAKRNIVVIGASAGGVVALKELVRSLPPDFNATIFIVQHIAAYATSMLPEILNHAGSLRA
VHPADGDSFQPGMIYIAPPDHHILIEEDRVLVKKGPKENRFRPSIDALFRSAAYNFGERA
IGVVLTGLLDDGTSGMWSIKRLGGIGIVQKPEDAEYSSMPSSVLEYVDVDYAVPLAKMGA
LLNQLTSEEITPPHLTLSPEEEQILKTEVQIASQKNAFEMGILEMGDLSPFTCPECSGVL
VRFREGKLIRYRCHTGHAYTAGSLLAEVDKSVEDNLWKAVRVIEEAIMLLEESGRASAEG
GDDLGAERFFTKARENRERASMLHKFIFQHEPVLQQNGVPNKAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacggaatattgttgtaattggcgcatcggcgggtggtgtggtggcgctcaaa
gagttagtacgctcgttaccacccgacttcaacgccaccatttttattgttcagcacatt
gcagcttatgcaacgagcatgctgccggaaatcctgaaccatgccggttcgctcagagca
gttcatccagccgatggcgattcgtttcagccgggcatgatttatattgccccgcccgac
caccatattctcattgaagaagaccgggtattggtcaaaaaagggcctaaagaaaatagg
tttcggccctcaattgatgccttgtttcggtcggccgcctataatttcggcgaacgggca
attggcgttgtgctgacgggcctgctcgacgatggtacgtcggggatgtggtcgatcaag
cggctggggggtatcggcatcgttcagaaaccggaagatgccgaatactccagtatgccc
tccagcgtactcgaatatgtggatgtagactatgccgtaccactggccaagatgggggca
ctgctaaatcagctgacctccgaagagattaccccaccccacctcaccctgtctcccgaa
gaggagcaaatcctgaagacagaagtccaaatagcctcccaaaaaaatgcatttgaaatg
ggaatactcgagatgggtgacctttcgccttttacctgcccggagtgcagcggtgtgctg
gtccgcttcagagaaggcaaattgatcaggtaccgatgccataccggacatgcctatacg
gcggggtcgctgctggccgaagtcgataaatcggtagaagacaacctctggaaagccgtc
cgggttattgaggaagccattatgctgttggaagagtcgggcagggcatcggctgagggg
ggcgacgacctcggggccgagcggtttttcacgaaagcccgcgaaaaccgcgaacgggcc
agcatgctccataaattcatttttcagcacgagccggtccttcagcaaaacggtgttcca
aataaggctgcctaa

DBGET integrated database retrieval system