KEGG   Spirosoma linguale: Slin_3227Help
Entry
Slin_3227         CDS       T01156                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sli  Spirosoma linguale
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Slin_3227
Enzymes [BR:sli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Slin_3227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3908943..3909728)
Genome map
AA seq 261 aa AA seqDB search
MNETSMQSTENRLTKVNRLLVTQSRPADEKSPYFDLVSKYNLQIDFRPFIQIQGESFKDF
RRQKINILAHTAIIFTSRNAIDHFFRICQEGRIEVPADMKYFCISEQTANYLQKYIVIRK
RKIFNGTKTATELFDLIKKHKNEKFLFPCSNIRRNDIPEFMDTSGLHFTEAVMYDTVPTD
LSDLDIESYDIIAFFSPSGVSSLMSNFPNFNQNGTRLAAFGPTTAKAIVEAGLTLDIEAP
LPNAPSMTGALDLYLKKANNL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaacaagcatgcaatccacagaaaaccggctcacgaaagtaaaccggctgtta
gtgactcaatcccgacccgccgacgaaaaatctccttattttgatttagttagcaagtat
aatcttcagattgactttcgcccgttcattcagatacagggagaatcattcaaggatttt
cggcgtcagaagataaatatcctggcacacacggctatcatttttaccagtcggaatgcc
atcgatcatttttttcggatttgccaggaaggtcgaattgaggtgccagctgatatgaag
tacttctgtatttcggagcagacagctaattatcttcagaaatacattgttatccggaag
cgtaaaatcttcaacggaacaaaaacagcaaccgagcttttcgatttgatcaagaagcac
aagaacgagaagtttttgttcccctgttccaatattcgccggaatgatattccagagttt
atggataccagcggccttcacttcaccgaggcagttatgtacgatacggtaccgactgac
ttatcggaccttgacattgaaagttatgatatcatagcttttttcagtccttcgggcgtt
agttcgttaatgagcaatttccccaactttaatcagaacgggacccggctcgcggctttt
ggccctacaacggccaaagccattgtggaagctggtttaacactcgatattgaagccccc
ttgcccaatgcaccgtctatgacgggtgctttggacctgtatttaaaaaaggctaacaat
ttataa

DBGET integrated database retrieval system