KEGG   Spirosoma linguale: Slin_3322Help
Entry
Slin_3322         CDS       T01156                                 

Definition
(GenBank) cupin
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4019842..4020609
Genome map
AA seq 255 aa AA seqDB search
MKLVVAFLLALGLFIKPDPTQPIVSKTYGWAQAPVTRKTASEQRAILEGTSTDFSHIEIH
ATTLPPHQAPHPAHKHDDEELIIIKEGKLTVTIAGKTKTLGAGSIALMMPGDEHGFDNQS
DAPATYYVMRYAAKEPADAERGKKAGGSFWIDWNDVAFQPHDKGGIRRMFDRATAMSKRF
EMHVTTLNQGLWSHPPHTHRAAEILLMVDNSAQESIDGKLHPATIGDLIFLESNVPHAIQ
NTGNKPCTYFAFQFE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagtcgtcgccttcctgctcgcccttggtttattcatcaaaccggaccctacg
cagcccattgtttccaaaacttacggctgggctcaggcacccgtaacccggaaaacggcc
tccgaacaacgggctattctggagggcacctcaaccgatttcagccacatcgaaattcat
gcgactacgctcccaccccatcaggctccacacccggcgcacaaacacgatgacgaagaa
ctcatcattatcaaagaagggaaactaaccgttaccattgcggggaaaaccaagacactg
ggcgccggaagtatagccttgatgatgcccggcgacgaacatggcttcgacaaccagagc
gatgcacccgctacctattacgtcatgcgttatgcagccaaggagccagcggatgccgaa
cggggcaaaaaagcgggtggctcgttctggatcgactggaacgatgtagcctttcaaccg
cacgataaaggcggtatccggcgcatgttcgaccgggctacggccatgtcgaaacgattc
gagatgcacgtcacgacgcttaaccagggcttatggagccatccgccccatacgcatcga
gcggccgaaattctgttgatggtcgataattcggcgcaggaaagtattgacggcaagcta
catccggccaccattggcgaccttatctttctggaatccaacgtgccccacgcaattcag
aatacaggcaacaagccctgtacctactttgcttttcagtttgagtga

DBGET integrated database retrieval system