KEGG   Spirosoma linguale: Slin_3328Help
Entry
Slin_3328         CDS       T01156                                 

Definition
(GenBank) xylose isomerase
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4024783..4025823)
Genome map
AA seq 346 aa AA seqDB search
MNNHASRRKFLGTTAALLAGTAAGTHKLFGAPALIRSLGDKPNSLIDGVQIGVITYSFRE
MPDQSAEATLQYVLDSGVSAIELMGGPAESFAGAPKSTVDMRLVFPLMRKKRENQPLTED
EQKMVTEAETQMKAYRAEMTKWRLSVPMSKFEQVRKMYNQAGVRIYGFKPDTFGMQSSDA
EIEYGLRAAKTLGANQVTLEHPANDAHTLKLGTMAQKQGMKVGYHGHEQQTPTFWDTALA
QSPANAMNFDLGHYVAAGNPDPLVLIKQKHDRIASMHIKDRQTADHGKGNLVWGQGDTPL
LQVLKLMREQKYNFPATVELEYKIPEGSNSVAEVKKCVNFCRNALS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcatgcttctcgccgtaagtttttgggcacaactgccgcactgctcgccgga
accgcagcgggtacccataagctctttggcgctcccgccttaattcgctcattaggcgac
aagccgaactccctgatcgacggtgtgcagattggtgtcatcacctattcatttcgggag
atgcccgatcagagtgccgaagctactttacagtatgtcctggattcgggcgttagcgcc
attgaattaatgggtggtcccgccgaatcatttgccggtgctccaaaaagcacggtcgat
atgcggttggtgttcccactgatgcggaagaagcgggaaaatcagccgctgacggaggat
gagcagaaaatggttaccgaagccgaaacccagatgaaagcctaccgggctgagatgacc
aaatggcggctctcggtgccgatgtcgaagtttgagcaggtgcgtaagatgtataaccag
gcgggagtgcgtatttatggcttcaagcccgatactttcgggatgcagagttcggacgcg
gaaatcgagtacggcctgcgggcggctaaaacgctgggagccaatcaggttacgctggag
catcccgccaacgacgcccatacgctaaaactgggtaccatggcccaaaaacagggcatg
aaagtgggctatcatggtcatgagcagcaaacgcctactttctgggataccgccctggcg
cagtcgcccgccaatgcgatgaacttcgaccttgggcattacgtggccgctggcaatcca
gacccccttgtattgattaagcaaaagcatgatcgcattgccagcatgcacatcaaagac
cgccaaacggccgatcacggcaaaggaaatctggtttggggtcagggcgatacgcctttg
cttcaggtgctaaagctgatgcgtgagcagaaatataatttcccagctaccgtcgaactg
gaatataagattccagaagggtctaattctgtagctgaagtgaaaaagtgcgtaaacttt
tgtcggaatgccttgagttag

DBGET integrated database retrieval system