KEGG   Spirosoma linguale: Slin_3330Help
Entry
Slin_3330         CDS       T01156                                 

Definition
(GenBank) DEAD/DEAH box helicase
  KO
K11927  
ATP-dependent RNA helicase RhlE [EC:3.6.4.13]
Organism
sli  Spirosoma linguale
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:sli00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Slin_3330
Enzymes [BR:sli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Slin_3330
Messenger RNA biogenesis [BR:sli03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     Slin_3330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4027184..4028527)
Genome map
AA seq 447 aa AA seqDB search
MTFDELNLNKPLLNALNDLGYTTPTTIQQKVFSVVMSGQDVCGIAQTGTGKTFAYLLPTL
RQMQFSKDRQPQLLIIVPTRELVVQVVDAVKKLTTYMNLTVVGVYGGVNMKAQTVEIMQG
LDVLVATPGRLADFMLGGTLKTKGIKKLVIDEFDEMLNLGFRAQLKVVLDLLPPKRQNLL
FSATLTDDVDQLVNDYFNKPVRVEAAPMGTPLEKIDQSGYRVPNFYTKINLLTLLLNRNA
AMTKVLVFVATKQLADQLFEQLESGFPDQVGVIHSNKAQNKRFEAVNNFKAGTYRILIAT
DIIARGIDVTDVSHVVNFDLPDLPENYIHRIGRTGRADREGIAVSFITESAREAQEAIEQ
LMNQPIPMLPLPENLVISDELTDDEKPKVHMKFIDVKPPKREDVGPAFHEKSAKNQKVNV
RRNIAEEKMLKYGRPIKRVGGKKKRDK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgacgaactgaatctgaacaaaccccttctgaacgccctcaacgatttgggg
tacaccacgccgacaaccattcagcaaaaggtattttcggtcgtgatgtcggggcaggat
gtgtgcggcatcgcgcagacgggaaccgggaaaacgtttgcctatctgttgcctacgctt
cgccagatgcagttttcgaaggacagacagccgcagttgctgatcatcgttcccacccgc
gaactcgtggtgcaggtggtcgacgcggttaaaaagctgacgacgtatatgaacctgacc
gtggttggcgtatacgggggcgtaaacatgaaggcgcaaacggtcgagattatgcagggg
ctggatgtgctggtggcaacccccggtcggctggccgatttcatgctgggcggtaccttg
aaaacgaaagggatcaagaaactcgtcatcgacgaattcgacgaaatgctcaaccttggc
tttcgggctcagttgaaagtggtgctcgacttactgccgcccaaacggcaaaacctgctg
ttctcggccacgctcacggacgatgtcgatcaactggtgaatgactacttcaacaaaccc
gttcgggtcgaagcggctccgatgggtactccgctggaaaaaatcgaccagtcgggctac
cgggtacctaacttttacaccaagatcaacctgctcacgctgctcctgaaccggaatgcg
gccatgaccaaagtgctggtctttgtggccaccaagcaactcgccgaccaactgttcgag
caactggaatcgggttttccggatcaggtgggggttattcattccaataaagcgcagaac
aaacgattcgaggccgtcaataacttcaaagccgggacctaccggattctgattgcgacg
gatatcattgcccgtggtatcgacgtgaccgacgtgtcgcatgtggtcaatttcgacttg
cccgacctacccgaaaactacattcaccgcattggccgaaccggccgggccgaccgcgaa
ggaatcgccgtttcctttattaccgaaagtgcccgtgaagctcaggaagccatcgagcaa
ctgatgaatcagccgatcccgatgcttcctctgcccgagaacctggtcatttcggacgag
ctaaccgacgacgagaagccgaaggtgcatatgaagttcatcgacgtcaagccacccaaa
cgggaagacgttggccccgcttttcatgagaaaagtgccaagaaccagaaggtgaacgtc
cgacggaatattgcagaggaaaaaatgcttaagtacggccgacccatcaagcgggtagga
gggaagaagaagcgggataagtag

DBGET integrated database retrieval system