KEGG   Spirosoma linguale: Slin_3331Help
Entry
Slin_3331         CDS       T01156                                 

Definition
(GenBank) DEAD/DEAH box helicase
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4028648..4029973
Genome map
AA seq 441 aa AA seqDB search
MITPQQQTQILTNLGISALNPMQEAALNAITQDNDTFLIAPTGSGKTVGFLLPILNLLKS
DQKTSVQCLVLAPSRELAIQIEQVWKKMATGFKVNVCYGGHPVETEIKNLSNPPALLIGT
PGRIADHITRRSFSLDGIHTLVLDEFDKSLALGFHDEMEFIVRGLRNLRKRVLVSATSGI
SIPAFIRLNMPTTLTFTAEKSEETGLTTKVVYAQSKDKIDTLFDLLCALDSESALIFLNH
REAAERTSELLAERGIHSLVYHGGMEQVDRERALIQFRNGSTRYLVTTDLAARGLDIPEM
KYVIHYHLPLQAHEFTHRNGRTARMHASGTAYVILSPDETRPVYLDPSLEEFRVPAGNAL
PKPPDFVTLYISGGKKNKLNKVDIVGFFSQKGGLEKGDLGRIDVQDFISFAAVKQDKVKG
LLAKISQEKMKGKKYKIEVAR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgataacccctcagcagcaaacacaaatcctgacaaacctgggcatttcggcgttgaac
ccgatgcaggaagccgccctgaacgccattacgcaggataacgatacatttttgattgcc
cccaccggctctggcaaaacggtgggttttctgttacctattttaaacctgctcaaatcc
gaccagaaaacgagtgttcagtgcctggttctggccccttcccgcgaattggcgattcag
atcgaacaggtctggaagaaaatggcgacgggttttaaagtcaacgtttgttacggcggg
cacccggtcgaaacggagataaaaaacctgagcaatccgcccgccctgctcattggcaca
cccggccgcattgccgaccatatcacccgccggagtttctcgctggacggtatccatacg
ctggtgctggatgagttcgacaaatcgctggcgctgggttttcatgatgagatggagttc
attgttcggggcctgcgtaatctccgaaagcgcgtgctcgtctcggccacatcgggcatc
agcatccctgcctttatccggctcaacatgcccactaccctgaccttcaccgcagagaaa
agtgaggaaaccggcctgacgacaaaggtggtctacgcgcagtcgaaggataagatcgac
accctgttcgatctgctctgtgccctcgattcggaatcggccctgattttcctgaaccat
cgggaagccgccgaacgtaccagtgagttgctggccgagcgcggcatccactcgctggtc
tatcatggcggcatggaacaggttgaccgcgaacgggcgctgatccagttccggaatggc
agcacccgctacctcgtcaccaccgacctggccgctcgtgggctcgacattcctgagatg
aagtacgtgattcactaccacttgccgttgcaggcgcatgagttcacacaccgcaacggc
cggacggcccggatgcacgcgtcgggaacagcctacgtgatcctatcgcccgatgaaact
cgcccggtttacctcgacccgtcgctggaggagttccgggtaccggcgggaaacgcgctt
cccaaaccacccgattttgtgacgctctacatcagtggcggcaagaagaataaactcaac
aaagtggacatcgtcggctttttctcccagaaaggtggcctcgaaaaaggcgacttaggc
cgcatcgacgtgcaagatttcatctcgtttgccgccgtgaagcaggacaaagtaaaaggg
cttctggcgaagattagtcaggaaaagatgaaaggcaagaagtacaagattgaggtggcg
cggtga

DBGET integrated database retrieval system