KEGG   Spirosoma linguale: Slin_3336Help
Entry
Slin_3336         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4035226..4036308
Genome map
AA seq 360 aa AA seqDB search
MNPSFLLSGLWTLMQPTVGDSVRQQIGIQAYTGFIIPHAPDLKAIAQSRPVGIELTYSRT
AFNRAAYERCNCFARTGGYINYTAFNNPAELGRTVGMGGYFEPLIRHRKSLYFSLRATAG
LAYITRVYNAESNPGNTFFSSPLSGMLALSASAHHRLTRHVHALVTAGYNHISNGGIRQP
NRGMNFPTLGLGVVYITNPMPLPKAADWAKPTIDSRFTKRVMGFSSVRTLPQTDDLPETA
GWLWGLSTTAGYRVSRFHAFTGGVEFVDDGYIREQLRRENQLTNHRQLGLLGGYELWLGR
YTFTTHLGWNLVQPASLPDGRLFQRYQLLYTLRDRYLVGVGLRARLNVAEGFDLRMGVRF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcatttctcctgagcggcctctggacattgatgcagccaacggtaggtgac
tctgtacggcagcaaattggtatacaggcgtataccgggttcatcattccgcacgcgccc
gatctcaaagccattgcgcaaagccgacccgttggtatcgaattaacttatagccgaacc
gccttcaatcgggcggcttatgaacgctgcaactgctttgcgcgtacgggtgggtatata
aattatacagcgttcaataaccccgccgaattgggccgaacagtgggaatgggcgggtat
ttcgagccgctgatccggcatcggaaatcactttatttttccctcagggcaacggctggc
ctggcctatatcacgcgggtgtataatgccgaatcgaacccaggaaataccttttttagc
tcaccactgagtgggatgctggccctttcggccagcgcacatcaccgtctgacgcggcat
gttcatgcattggtaacggctggttataaccatatttccaacggaggcatccgccaaccc
aatcggggcatgaattttcctacgctggggttgggggtagtgtacataaccaatccaatg
cctttgcccaaggcagctgactgggcgaaaccaacgattgacagccgatttacaaaacgg
gtgatgggatttagctcggtgcggacgttgccccaaacggatgatctgcccgaaacggct
gggtggctttggggcttgtcaaccacagccgggtaccgcgtcagccggtttcatgctttc
acgggtggggtggagtttgtggacgacggctatattcgggaacagctccgccgggaaaat
cagctgaccaatcaccgtcagctgggtttgctgggtggttacgagttgtggcttggccgg
tacacgttcacgacgcatctgggctggaacctcgttcaaccggcgtccctgcccgacggt
cgcctttttcaacgataccaactcctatatacgttacgtgaccgctatctggtgggcgtc
ggccttagagccagattgaacgtagccgagggattcgatctgcgaatgggggtacgattc
taa

DBGET integrated database retrieval system