KEGG   Spirosoma linguale: Slin_3339Help
Entry
Slin_3339         CDS       T01156                                 

Definition
(GenBank) ECF subfamily RNA polymerase sigma-24 subunit
  KO
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
sli  Spirosoma linguale
Brite
Transcription machinery [BR:sli03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Slin_3339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4038780..4039298
Genome map
AA seq 172 aa AA seqDB search
MDLHVFKKRILPVQGRLFRLAQLFLRNREEAEDTLQDVLLRLWTNRQQLDSYHSVEALAV
QMTRNICLDKLKAHVRQKTTDDTDLPGVQAEDASPYQQLELSDSVRLMHRLIDDLPEQQR
FILHLRDVEEYSFDEIEQVTGLSINNIRVILSRARQRLRDRYIKTNDYEAGY
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggatctacacgtcttcaaaaaacggatactgcctgttcagggacgcctttttcggctg
gcgcagttgtttctacgcaatcgcgaagaagcggaagacacgttgcaggatgtactactg
aggctatggacgaaccgacaacagctggattcgtatcatagcgtagaagcgctggcagtc
cagatgacccgaaatatatgcctggacaaacttaaagcccatgttcgacagaaaacaacg
gacgacaccgacctgccgggcgttcaggcggaggatgcctctccctaccagcagttagag
ctatccgacagtgttaggctcatgcatcgactgatagatgacttgccggaacaacaacga
ttcattttacatctgcgtgacgtggaagagtattcattcgatgaaatcgaacaggtaaca
ggtctcagtattaacaacattcgggtgatcttatcgagagcccgtcagcggctacgagat
aggtatataaaaaccaacgactatgaagcaggatattga

DBGET integrated database retrieval system