KEGG   Spirosoma linguale: Slin_3343Help
Entry
Slin_3343         CDS       T01156                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  
gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sli  Spirosoma linguale
Pathway
Taurine and hypotaurine metabolism
Cyanoamino acid metabolism
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Slin_3343
   00460 Cyanoamino acid metabolism
    Slin_3343
   00480 Glutathione metabolism
    Slin_3343
Enzymes [BR:sli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Slin_3343
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione hydrolase
     Slin_3343
Peptidases [BR:sli01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   Slin_3343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4042025..4043764
Genome map
AA seq 579 aa AA seqDB search
MNTPIAFCLGLFWFITVPLYGQPTGKGDRITGPNFATRSPILGRHGMVATSHPLATEIAL
DILKQGGTAVDAAIAANAALGVVEPNNGGIGGDLFALVWSAKDHKLYGLNASGRSPKSLT
YSSLRTKLGDQAHIPLYGPLSVSVPGTVDGWFTLHQRFGKLPVRTLLAPSIRYAREGVPV
PQVIAYSWQVAAARLAASERIVEEFDNFRNTFLINGKAPVEGQVFRNPDLAVTYEKIAAG
GRDAFYKGTLADVMGRYARRAGLYLRKADLATHKSTWVDPVSVNYRGYDVFELPPNGQGI
AVLQMLNLLEGYDLKSLGHNSADYLHLLVEVKKLAFEDRARYYADPEFSTIPVSQLLAKE
YAANRRQLIDPKKASERLDAGEPTLRSGDTVYLTVADEQGNMVSLIQSNMLEFGSGMVPD
GLGFVFHNRGTSFNLNPGHANVYAPAKRPFNTIIPGFVMKGGEPFLSFGVMGGAMQPQGH
VQVLCNIIDFGMNVQEAGDAARFSHSGSSEPIGTVMTDGGKLALESGISANVRAELEKRG
HHLAPTDFFGGYQAIQWDLVNRIYRGSTEMRKDGQAAGY
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaataccccgattgccttctgtctagggttattttggtttatcacagtacccctctac
ggccagccaaccggtaaaggtgaccggattacggggcctaactttgctacccgcagcccg
attctgggacgacacgggatggtcgctacgagccacccactggctacagaaattgcgctg
gacattcttaagcagggcggcacggccgtcgatgcagccattgcggccaatgccgccctc
ggggtagtcgagccgaataatggtggtatcgggggcgacctgttcgcgcttgtctggtca
gcgaaagaccataaactatacggtctgaacgccagcggccgatcgcccaagagtttgacg
tatagcagcttacgaactaaactgggggatcaggctcacattccgctatatggcccgctg
tccgtatcggttccgggaacggtagacggctggttcaccctgcaccagcggtttggcaag
ctgcccgttcgtacgctgcttgctcccagcattcgctatgcacgggaaggcgttccggtg
ccgcaggtaatcgcctactcctggcaggtggcggcagcccggttagccgccagcgagcgc
attgttgaggagttcgacaatttccgaaatacgtttctgatcaacggcaaagcacccgtc
gaagggcaggtattccgcaacccggatctggcagttacctacgaaaaaatagctgccgga
gggcgtgatgccttctacaaaggcacccttgcagacgtcatgggccgctatgcccgccgg
gccggtttatacctccgtaaagccgacctggctacccataaaagtacctgggtcgacccg
gtttcggtaaattatagaggttacgacgtcttcgaattaccacccaatggacagggcatt
gccgttctgcagatgcttaatctgctggaaggttatgacctcaaaagccttgggcacaat
agcgccgactatctgcatttattggtcgaagtcaagaagctagccttcgaagaccgggcg
agatactatgccgaccccgaattttctactatccccgtaagtcagttgctcgccaaggag
tacgcagccaaccgacgtcaactcattgatccgaaaaaagcgtcggagcgactggacgcc
ggtgaaccaaccctccgttcgggcgacaccgtttacctgaccgtagccgatgagcagggc
aatatggtatcactcatccagagtaatatgctggaatttggcagcggtatggtgcccgac
ggccttgggtttgtctttcataaccggggcaccagtttcaacctgaaccctggtcatgcc
aacgtgtatgccccggccaaacggccgttcaatacgatcattccgggttttgttatgaag
ggtggggagccgtttttaagctttggggttatggggggcgctatgcagccgcagggtcat
gtgcaggtgctgtgcaacatcatcgacttcggcatgaacgttcaggaagcaggtgatgcg
gcccggttcagccactcgggtagtagtgaacccattggcacggtcatgaccgacggcggc
aagctggccctcgaaagcggcatctcggccaacgtccgagccgaactcgaaaagcgcggc
caccacctagctccaaccgatttttttgggggctatcaggccattcaatgggatcttgtc
aatcgaatttaccgggggtcaacggagatgcgaaaagatggtcaggccgccggttactag

DBGET integrated database retrieval system