KEGG   Spirosoma linguale: Slin_3344Help
Entry
Slin_3344         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4043997..4044635
Genome map
AA seq 212 aa AA seqDB search
MANLADRIASFFSGNDSNTDEGLRDLFISELKSVYYAEKRAVDALGDQAEASTTNEVRSA
FLAHQEQSRIQVERLEEIFRIIGIKIDTHLSDGIDGLIGDAKRVISETESGSLTRDAGLI
IAAQKIEHYEIAAYGSLLTLARTLDFSQSAELIEKTLEEEKEEDHKLTILAQSFVNKRSK
EEEEKHPGSHHASRPVPHSSDSDITLGGPLGV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacctggcagatcgtatagcaagtttttttagtggtaacgattccaacaccgat
gaaggattacgcgacctctttattagtgagctgaaaagcgtttactatgcagagaagcga
gccgtcgatgccctgggcgatcaggccgaagcaagcacaacgaatgaagtgcgcagtgct
tttctggcccatcaggagcaaagccgtattcaggtggagcgactggaagaaattttcagg
attatcggcatcaaaatagacacacatctatccgatggtatcgacgggctgattggtgat
gcgaaacgggttatttcagaaacagaatcaggctcgttgacacgcgatgccgggctaatt
atagcggcccaaaagattgagcactatgaaattgcagcctatggatcactccttacatta
gcgcgcacgcttgacttcagccagtcggccgaattaattgaaaagacgctggaagaggaa
aaagaagaagatcacaaactgactattctggcacaatcgttcgtaaacaaacgctccaaa
gaggaagaggaaaaacaccccggcagccaccacgccagccgacccgttcctcatagctcc
gactcagatatcacgttgggcggaccactgggcgtttaa

DBGET integrated database retrieval system