KEGG   Spirosoma linguale: Slin_3348Help
Entry
Slin_3348         CDS       T01156                                 

Definition
(GenBank) Bcr/CflA subfamily drug resistance transporter
  KO
K07552  
MFS transporter, DHA1 family, multidrug resistance protein
Organism
sli  Spirosoma linguale
Brite
Transporters [BR:sli02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    Slin_3348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4049998..4051233
Genome map
AA seq 411 aa AA seqDB search
MTRRQHFVIILILGALSTISPFSIDMYLPGFPAIAKDLHTSISQVQLSLTAYLVGISVGQ
LLYGPLLDRFGRKLPLYAGLMVYFIASIGCAFSSSIEMLIAMRLLQALGGCVGLVAAQAL
VRDLFPVGEIAQVFSLLTLVVAVSPMIAPTVGGYATVAFGWHSIFVILAIITLLMLVGVY
FVLPNGKAPDASLSLRPKAVMGSFYTVLKQPQFLTYALVGGIATSAPFAYLAGSSDVFMN
IYHVSAQEYGWIFAFLAIALIGPTQLNRFLLRRFSNEQIIFATLIYQTVVGLLLVLGTWA
GWYGQYGLIGMLFLFLGGQGITNPNASALSLAPFSRHAGSAAALMGSFRMGFGSLVSASV
SLLHNNTAIPMVGIMTACIILGLVILLIGERVIRHQAKSADLDGPMAEALL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgactcgccgacagcattttgttattatcctgattttaggggcactctcgacaatcagt
ccgttttccatcgacatgtatttgccaggctttccggctattgccaaagacctccacacg
tccatatcgcaggttcagctttcgctcacggcttatttggtgggtatttcggtcgggcag
cttttgtatggtcccctgctcgaccggtttggcaggaagctcccattatatgcggggttg
atggtatatttcattgcctcgattggctgtgcgtttagttcgtcaatcgagatgctgatt
gccatgcgtctgttgcaggccctgggcgggtgtgtggggctggtagcagctcaggcactg
gtgcgtgatctgtttccggtgggtgaaattgcccaggtcttttcgttgcttaccctggtg
gtggccgtgtcgcccatgatagcgccaaccgtgggtgggtatgccactgttgcgtttggc
tggcactcgatcttcgtcattctggccatcatcaccctcctgatgctggttggcgtgtat
ttcgttctgcccaacggcaaagcccccgatgcctccctgtccctccgcccgaaggccgtt
atgggcagtttctatacggtactgaagcaacctcaatttctgacctatgcgctcgttggc
ggcattgccacgtcggccccgtttgcctatctggcgggttcctccgatgtgttcatgaat
atctaccacgtcagcgctcaggaatacggctggattttcgcttttctggccatcgccctg
atcggcccgacgcagttgaatcggttcctgctccggcggtttagtaatgaacagatcatt
tttgccacgctgatctaccaaacggtggttggcctgcttcttgtgctgggtacctgggcg
ggctggtatgggcaatatggcctgatcggtatgctgttcctgtttctgggcgggcagggc
attaccaaccccaatgcctcggcgctgtcgctggcaccgttttcccgtcatgcgggtagt
gcggctgcgctgatgggcagcttccggatgggcttcggctcgctcgtttcggcgtctgtc
agcctgttacacaacaacaccgctattccgatggtggggatcatgactgcttgtattatc
ctggggctggtcattctgctgattggcgagcgggtcattcgccatcaggccaaatccgct
gacctggacgggccaatggccgaggctttgttataa

DBGET integrated database retrieval system