KEGG   Spirosoma linguale: Slin_3354Help
Entry
Slin_3354         CDS       T01156                                 

Definition
(GenBank) glyoxalase/bleomycin resistance protein/dioxygenase
  KO
K07032  
uncharacterized protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4058919..4059350)
Genome map
AA seq 143 aa AA seqDB search
MATQIFVNLPVKDLTKSIEFFTRLGYSFNPQFTDEKATCMIISEDIYIMLLVEEFFKSFT
KKEIANTAQSAEAIICLSSESREAVDEWVRKAVAAGATTPNEPQDHGFMYGHGFQDLDGH
LWETMYMDPSYIQQEQPASEVSA
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccaaatctttgtaaatctgcccgttaaagacctgacaaaatccattgagttc
tttacccgcctggggtatagtttcaatcctcagtttacggacgaaaaagccacctgcatg
attatcagcgaggatatttacatcatgttgctggttgaggagtttttcaagagtttcaca
aagaaggagattgcaaataccgcccaaagtgccgaagccatcatctgcctttcgtcggag
agccgggaagcggtcgatgagtgggtacgcaaagccgtagccgccggggccaccacgcca
aacgagccgcaggatcacggcttcatgtacggccacggctttcaggatctggacggccac
ctttgggaaaccatgtacatggaccccagctatattcagcaggagcaaccagcttcggag
gttagtgcgtag

DBGET integrated database retrieval system