KEGG   Spirosoma linguale: Slin_3356Help
Entry
Slin_3356         CDS       T01156                                 

Definition
(GenBank) chitinase
  KO
K01183  
chitinase [EC:3.2.1.14]
Organism
sli  Spirosoma linguale
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Slin_3356
Enzymes [BR:sli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     Slin_3356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4059556..4060677
Genome map
AA seq 373 aa AA seqDB search
MIRPVYTFLLVSFTLLLLVAFKPKPTAKPIVLAYVGGFRGLVDTEKIAAEKITHINYAFV
DVRKNRAWLHNLATDSTNFRKLNLLKRRNPDLKILISLGGWSWSENFSDAVVSDTGRVAF
AASAVDIIREYQLDGIDIDWEYPGMKGEDNVFRSEDKENFTLLFKSLREQLNSLKKQTGK
DYLVTTALPGFEAIFTHTDMAQAQQYLDYINVMSYDFFTGGPQAGHHTNLYASGKVDKES
SGDLSVKRYEQAGVPANKLLLGIAFYGRAWQLQDGNPKTHPRTITKVERGGGYTFIKDSL
LTNPAYKRHWDRRAKAPYLYNADLKRFVSYDDEKSVKAKCDYVKKNGLAGVMFWEYFSDP
KGYLLNEIDRQFL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaccggtatacaccttcctactagtctcattcaccctactgcttttggtggcg
ttcaaacccaaacccaccgccaaaccaattgtgctggcttatgtgggcggatttcgcgga
ctggtggacaccgaaaaaattgccgccgaaaaaatcacgcatatcaactacgcctttgtc
gatgttcgaaaaaaccgggcgtggctccacaacctcgctaccgactccaccaatttcaga
aaactcaacctgctcaaacgacgtaatcctgaccttaaaatcctgatttcccttggcggc
tggtcctggagcgagaacttctccgacgcagtcgtgagcgataccggtcgagtcgcattt
gctgcgtcagccgttgatattatccgggaataccagctggacggtatcgacatcgactgg
gaataccctggtatgaaaggcgaagacaacgtgttccggtccgaagacaaagaaaacttc
accctgcttttcaaatccctgcgcgaacagttgaacagtctgaaaaagcaaacgggcaaa
gactatctcgttacgacagctctacccggcttcgaggccatttttacgcatactgatatg
gctcaggcccagcaatatctggattacattaacgtgatgtcgtacgatttctttacggga
gggccacaggccgggcatcatacgaacctgtacgcatccggtaaagtcgacaaggaaagt
tccggcgatctatccgtgaaacggtacgaacaggcgggggttccggccaataagcttttg
ctgggcattgccttctatggccgggcgtggcagttacaggacggaaacccaaagacccat
ccaagaaccattactaaagtggagcggggcggtggctacaccttcattaaagacagcctg
ctcaccaacccggcctacaaacgccactgggaccgacgcgccaaagccccttacctatac
aatgccgacctgaaacggtttgtctcctacgatgacgagaaatccgtaaaagccaagtgc
gattacgtgaagaaaaacggcctggcgggtgtgatgttctgggaatacttcagcgacccc
aaagggtatctgctaaacgaaattgaccgccagtttttgtaa

DBGET integrated database retrieval system