KEGG   Spirosoma linguale: Slin_3360Help
Entry
Slin_3360         CDS       T01156                                 

Definition
(GenBank) glycoside hydrolase family protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4063210..4064778
Genome map
AA seq 522 aa AA seqDB search
MRKQLLTIIFTVAIAWQALAQSTQLSRQRVTYTNPVIEGDFADPSIIRVGDTYFAVGTSS
EWGPAFPIYTSKDLVNWAYIGPAFDQLPQWTMGSYWAPELFYEKGTYFLYYTARRKTDQR
SFIGVATTHDLMKGFTDHGLLLEWTAEAIDPFIIDDAGKRFITWKAYGLDRGRSIEILGA
ELSANGLKVSGPAFSLIKAEAGNWEKGGAEGQAIFKRGSYYYMLYSGNACCGLQCNYQVG
IARAQTLQGPWEKYANNPLLVSDTTWKCPGHGTVVVTPDQRYFYLHHAYNGVDFTLTGRQ
GVLSELIWDEQSQWPVFRYGRSTPSQAESPLQARQKRQSNLTIDFSQPLKKAPWVWDVSL
PKPVYRVQQGQLQLVNQGSSQTGTFLGLVIRKGTFTLSADIIPQVDLLQSLCLYGDAQNQ
LGIGIRSGLLELWQLKAGTRSVLKTQSIPAGISSVTLQIRSRGQHLYEFGWGSKTGGFKL
ITDAPLNGSFLPRWDRAPRAGIGLLGKDKVSSMVRTITAHYD
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacaattacttacaattatttttaccgtagctatagcctggcaggcattagct
caatcgacacaattatctagacaaagggtaacgtataccaatccagttattgaaggcgac
tttgctgacccttccatcattcgggtaggtgacacctatttcgccgttggcacatcctcg
gagtgggggccagccttccctatctatacctcaaaagaccttgtgaattgggcttatata
ggccctgcctttgaccaactaccccaatggacgatgggtagctactgggctcctgagcta
ttttatgagaagggcacttattttctgtattataccgctcgacgaaaaaccgaccagcga
tcgtttattggcgtggccactacgcatgacctgatgaaggggttcaccgaccatggctta
ttgctcgaatggacggccgaagcaattgatccctttatcatcgacgatgccggtaaacgg
tttataacctggaaagcttacgggttggatcgaggcaggagcattgaaatactgggggcc
gaactgtcggccaacggactcaaggttagcggacctgctttctcgcttatcaaggcggag
gcaggcaactgggaaaaaggaggagccgaaggacaggcaattttcaaacggggcagctac
tactatatgctctactcgggcaacgcctgttgtggtctacagtgcaactatcaggtcggt
atagcgcgggctcaaaccttgcagggaccatgggaaaagtatgccaataatccgctctta
gttagtgataccacctggaaatgccccggacatggtaccgtggtggtaacgcccgatcag
cgatacttctacttgcaccatgcctataacggtgttgacttcaccttaaccggccgtcag
ggcgtactgagtgagttaatctgggatgagcaaagtcaatggcccgtttttcggtatgga
cgctcaacgcccagtcaggctgagtcaccgctacaggccaggcaaaaacggcagtcaaac
ctgacgattgattttagccaacccctaaaaaaagctccctgggtctgggatgtgagcctt
cccaagcccgtctatcgggtgcagcagggacagttgcagctcgtcaatcagggctcaagc
cagacgggtacctttctgggtctcgtcattagaaaaggcacctttactctgtcggccgat
atcatcccccaggtcgatctacttcaaagtttgtgtttgtatggggatgcccaaaatcaa
ctaggcattggtatcaggtctggattgcttgaactctggcagcttaaagccggaacgcgt
agtgttctgaagacgcagtccataccagccggtatttcttctgttacgctgcaaatacgg
agccgggggcagcatttgtatgagtttggctgggggtccaaaactggtggatttaaactc
ataacggatgccccattgaatgggtcttttttacctcgctgggaccgtgcaccccgtgct
ggtattggcctgcttggtaaagacaaggtaagcagtatggtacgaaccataacggcccac
tacgactaa

DBGET integrated database retrieval system