KEGG   Spirosoma linguale: Slin_3362Help
Entry
Slin_3362         CDS       T01156                                 

Definition
(GenBank) proline-specific peptidase
  KO
K01259  
proline iminopeptidase [EC:3.4.11.5]
Organism
sli  Spirosoma linguale
Pathway
Arginine and proline metabolism
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Slin_3362
Enzymes [BR:sli01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.5  prolyl aminopeptidase
     Slin_3362
Peptidases [BR:sli01002]
 Serine Peptidases
  Family S33
   Slin_3362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4066093..4067133)
Genome map
AA seq 346 aa AA seqDB search
MKYLCLLLLCTAALSWSCRSSETDTTLKSYFTSDTSGVATGGMRFVPIKTPKGNFKVWTK
RFGNNPKIKLLLLNGGPGATHEYFEVMESFLPAEGIEFIYYDQLGTGNSDNPNDTTFWDL
PRYVEEVEQVRAALNLTPDNFYLLGHSWGGILATEYALKYGKNLKGLVISNMMSSCPDYG
KYADNVLAKQMDPAVVKEVNDIEARGAYTSPRYMELLLPNFYAKHICRLPLDQWPEPMTR
ALNKTNQSLYVTMQGPSEFGIAGNLVNWDRKADLPKITVPTLTIGAQYDTMDPEHMKWMA
TQLPNGSYLYCSNGSHMSMYDDQKTYMNGLIKFIKGVDKGEKKVAL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacctctgcctacttctgctttgtacggctgcgttaagctggtcgtgccggtcg
tccgaaactgataccaccctcaaaagctactttacgtcggatacgagcggagtggctacc
ggcggaatgcgttttgtaccgattaaaacacccaaaggcaattttaaagtctggacgaaa
cgctttggcaataacccaaaaattaaactgctgctccttaacggtggacccggtgccaca
cacgaatactttgaagtaatggagagcttcctgcccgccgaaggcatcgaatttatctat
tatgatcagctgggaacgggtaactccgataatccgaacgacacgacgttctgggatttg
ccgcgctacgttgaggaagtggagcaggtgcgggcggccctgaatctgacacctgacaat
ttctacctgctgggccactcgtggggtggtattctggcgacggagtacgccctcaaatac
ggcaaaaacctgaaagggctggtgatctccaatatgatgtcgagttgccccgactacggc
aagtatgccgataacgtgctggcaaaacagatggatcccgccgtggtgaaggaggtgaac
gacattgaagcccgaggtgcgtatacgagcccccggtacatggaactgctcctgccaaac
ttctacgccaaacatatttgtcggctgcccctcgaccagtggcccgaacccatgacccgc
gccctgaacaaaacgaaccagtcgctgtacgtgaccatgcagggaccaagcgaatttggt
attgcgggcaatctcgtcaactgggaccgcaaagccgacctcccgaaaattaccgtgccc
accctgaccatcggtgcccaatacgacaccatggacccggagcatatgaaatggatggcc
actcaactgcccaatggcagctatctctactgctccaacggcagtcacatgtctatgtac
gacgaccagaaaacgtacatgaacgggctgattaaatttataaaaggcgttgacaaagga
gagaagaaggtggcgctgtaa

DBGET integrated database retrieval system