KEGG   Spirosoma linguale: Slin_3363Help
Entry
Slin_3363         CDS       T01156                                 

Definition
(GenBank) cupin
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4067405..4067950
Genome map
AA seq 181 aa AA seqDB search
MAALSALAAVPSLAFSEFRKTFLPDRGFKVNAGESRKRGHLRLKGVNVNILDVKISGSDT
NGGMAIFEQTSLSPKRGTPLHVHLEQDEVFYVIEGAYYFQVGDEKFDLKAGDSIFLPRNV
PHAWTQVADKGKMIVVFQPAGKMEDFFVSLSGMDHDPSPEEIARLFKDNQMQIVGPPLKV
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcagctctctccgcgctggcagccgtgccatccctggcattttccgaatttagaaaa
acgtttttacccgacagaggcttcaaagtgaatgcgggcgaaagccgtaaacgtggtcat
ctaagactcaagggcgtcaacgtcaacattcttgatgtaaagatttcgggcagcgatacc
aacggcggtatggctattttcgaacaaacctccctgtcgccaaaacggggtacaccactg
cacgttcatctggagcaggatgaggttttctacgtgatcgaaggggcttactattttcag
gtaggcgacgaaaaattcgatttgaaggccggtgacagcatttttcttccccgcaacgta
ccccatgcctggactcaggtggctgataaaggtaaaatgattgtggtgtttcaaccggcg
ggtaaaatggaggatttctttgttagtttgtccggtatggaccacgaccccagtccggaa
gaaatagccaggttattcaaagacaaccagatgcagatcgttggcccgcccttaaaagta
gattga

DBGET integrated database retrieval system