KEGG   Spirosoma linguale: Slin_3373Help
Entry
Slin_3373         CDS       T01156                                 

Definition
(GenBank) DinB family protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4074965..4075510)
Genome map
AA seq 181 aa AA seqDB search
MNKLPFRFALALMSLLCAFSVVQAARPMTTITQLTADWQRAKEYTKEYLDVMSEDGVNYK
PTPEIRSFAEQMLHLTAANYNFGAMVSGKPNPMQGKKLEEMSELKTKAALTKAVMDSYDF
MIDAVKGLTDAQLAENVKMGQREMTREVLLAKAFEHQTHHRGQCTIYIRMKGIKPPNEKL
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaataaactaccttttcgatttgcactggctctgatgagcctgttatgcgctttttcg
gttgttcaggccgcccggcccatgaccaccattacgcaactcaccgccgactggcagcgg
gcaaaggagtacacgaaggaatacctggacgtgatgtcggaagatggtgtaaactacaaa
ccaacgcccgaaatccgcagttttgccgagcagatgctgcacctgacggcagccaactac
aactttggcgcgatggtgagcggcaagccaaaccccatgcaggggaaaaagcttgaagag
atgagtgagttgaaaacgaaagccgcgctgaccaaagcggttatggacagctacgatttc
atgatcgacgcggttaaggggttgacggatgcgcaactggccgagaatgtgaaaatgggc
cagcgggaaatgacgcgcgaagtactgcttgccaaagcgtttgagcaccagacgcaccac
cgtgggcagtgtacaatttacatccggatgaaaggcatcaagccaccaaatgaaaaactg
ttttaa

DBGET integrated database retrieval system