KEGG   Spirosoma linguale: Slin_3376Help
Entry
Slin_3376         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
  KO
K09954  
uncharacterized protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4078463..4078705
Genome map
AA seq 80 aa AA seqDB search
MDMMNDPAKGNSDILRELLHYQMPFGKYKGHLIRTLPISYLEWFVQKGFPAGKLGMLLQT
MYEIRLNGLEYLLDGLRKGN
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggatatgatgaacgaccccgccaaaggcaacagcgatattttaagagaattacttcat
tatcagatgccctttggcaagtacaaagggcatctgatcagaacactgcctatttcgtac
ctggagtggttcgtgcagaaaggcttccccgcaggcaagctgggtatgctcctgcaaaca
atgtacgaaatccggctcaacggactggagtacctgctggatgggctgcggaaaggaaac
tga

DBGET integrated database retrieval system