KEGG   Spirosoma linguale: Slin_3382Help
Entry
Slin_3382         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4087131..4087793
Genome map
AA seq 220 aa AA seqDB search
MKIKAIITGATGMVGEGVLHECLQQPEVEAVLLINRNPSGVSHPKVSEIIHKDFFDLSSI
ESQLSGYNACFFCLGVSSVGMKEDEYRHLTYDLTLHVAETLARLNPDMTFGYISGAGTDS
TEQGRSMWARVKGATENALMRLPFKKAYMFRPGFMKPTPGLKNTLVYYKYINWLYPIGRA
LYPAGFSTLQELALAMIKSVSVGYEKSILEVKDIVDLAKR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaagcaattataaccggtgctacgggcatggtaggcgaaggcgtcctgcac
gaatgtttacagcaacccgaggtagaagcggtactgctcatcaaccgcaaccccagtggt
gtatcgcacccaaaagtcagcgagattattcacaaagatttcttcgatctgtcgtccatc
gaatcgcaactgagcgggtacaacgcctgctttttctgcctgggggtatcgtcggtagga
atgaaggaggacgaataccggcacctgacctacgacctgacgctacacgtagccgaaacg
ctggcccggctcaatcccgatatgacctttggttatatctcgggcgcaggaaccgacagc
accgaacagggacgcagcatgtgggcgcgggtgaaaggtgctaccgagaatgccctgatg
cggctgccgttcaagaaagcgtatatgtttcggccgggcttcatgaaaccaacccccggt
ctgaaaaacacgctggtctattataaatacatcaactggctgtatcctatcggccgggcg
ctttacccggcgggcttttcaaccttgcaggaactggcgctggccatgataaagtcggtc
agtgttggctatgaaaagtcaattctggaagtaaaggatattgtcgatctggcaaagcgg
tag

DBGET integrated database retrieval system