KEGG   Spirosoma linguale: Slin_3389Help
Entry
Slin_3389         CDS       T01156                                 

Definition
(GenBank) anti-FecI sigma factor FecR
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4093140..4094207
Genome map
AA seq 355 aa AA seqDB search
MNTPSPDYSRYSLNEFVLDDSFRQWVLQPNEQSMTFWHGFMLQHPEKQAIVDEAASLLLH
LNVRFNDLTNASQERIWQALNQAFDEHEAKQVSVRPLTGWQRFLGQRASFGWQLAASITG
FLLLVGGLTYYKLLPKEQRIHTAFGENKTVTLPDGSTVLLNGNTTLTYTDGWTDGKSREV
WLDGEGFFTVTKKSHRGGRVKFVTHTSGLDIIVLGTQFNVNTRRGSTAVTLVEGKVQLSK
PDEPAGKVIEMKPGQFAATKPSIEAVEIREEKPQLHTSWVEHQFVFENTALSDIAQQLHD
TYGLEIVFEDSDLANRRFTGNLSDQSIETLLATLSLTFDLTAHRNGDRISLRHNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgccttcacccgattacagccgttactccctcaacgagtttgtgctcgatgac
tcattccgccagtgggttctgcaacccaacgagcagagtatgacgttctggcatggcttc
atgcttcagcatccagaaaaacaagccatcgtcgatgaagccgcttcgttactactgcac
ctgaacgttcgctttaacgacctgacaaatgcgagtcaggagcgaatctggcaggcgcta
aaccaggcctttgatgagcacgaggccaaacaggtaagtgtccgcccgctgacgggctgg
cagcgtttcctggggcaacgagcctcctttggctggcagttggccgcatccataacgggt
tttctgctgctagttggtgggcttacgtactataagttactccctaaagaacagcgcatt
cacacggctttcggcgagaacaagaccgttacgctgcccgacggctcaacggtactcctg
aatggcaacaccacccttacctataccgatggctggaccgacggcaaatcccgcgaggtc
tggctcgatggcgaaggtttttttaccgttacgaaaaagagccaccggggcggccgggta
aagttcgtgacgcacacatccgggctggatattatcgtgcttggcacgcagttcaacgtg
aacacccgccggggcagtacggccgttacgctggtggaaggtaaggtgcaactgtctaaa
cccgacgagccagcgggcaaggtgatcgagatgaagcccggccagtttgccgccacgaaa
ccctcgatcgaagccgtcgagattcgggaggagaaaccccaactgcacacgtcctgggtt
gagcatcagtttgtattcgagaacacggcgctgagcgacattgcccagcagcttcacgac
acctacgggctggaaattgtctttgaagacagtgacctggccaaccgtcggtttacgggt
aatctgtcggatcagagcatcgagaccctgttagctaccctttcgctcacattcgacctg
acggctcatcgcaacggcgaccgtatcagtttacgtcataacccctga

DBGET integrated database retrieval system