KEGG   Spirosoma linguale: Slin_3391Help
Entry
Slin_3391         CDS       T01156                                 

Definition
(GenBank) RagB/SusD domain-containing protein
  KO
K21572  
starch-binding outer membrane protein, SusD/RagB family
Organism
sli  Spirosoma linguale
Brite
Transporters [BR:sli02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   Slin_3391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4097796..4099319
Genome map
AA seq 507 aa AA seqDB search
MKNRFISLTIAAALAFTGCQRSLDIVNPNQVTAESFWKTPTDALAGVNAIYSTTHRGGIS
RWMPFYYIIRSDEGRSQSPDVGIVNNMDQFLITDYNYGNAYSIWNDNYIGINRANQVIDN
VPNIQMDATLKGRYIGEAKFLRAMYYFHLVTLWGNVPLILQTSVVGDKPNSATTAQVWAQ
IEKDLTDAAAVLPTTYGNADLGRATKGAAYALLARAQMQQQKYTEALTPLQWLVEGDGKS
VYSLMPNYRDNFLITTENNKESVFEWQFQINPAEYTDDDTETPNQNYGTSLAKFFGPPPV
GWSDGEAQRWPTREFTERTTTGARDPRLEASFLFDSTDVRGPDFTQIYGQTFTQRYGRDN
KRVWFRKFQNDHWKTEEDYRSPNNWRYIRYADVLLMYAEALNATGKTTQAYTYVDQVRQR
AGLPTLTVAKPGLTQAQFLAQLKHERLLELSGEGWRWNDLARWGDLGPQLAPRDPAFSTF
VKGKSELLPIPQLDRDLNPNLVQNPNY
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagattcatttcgctaacgatagccgcagccctggcctttacgggttgccag
cgtagcctcgacatcgtgaaccccaaccaggtgacagccgagtcgttctggaaaacgccg
accgatgcgctggcgggtgtcaatgccatctacagcaccacgcaccggggcggtatttcg
cgttggatgccattctactacatcatccgttccgatgaaggacgcagccagagcccagac
gtcggcattgtcaataacatggaccagttcctgataacggactataactacgggaatgca
tattccatctggaatgacaactatatcggtattaaccgagccaatcaggtcatcgacaac
gtacccaacattcagatggacgctacgctgaagggccggtatataggcgaggccaagttc
ctgcgggccatgtattatttccacctggttacgctttggggcaacgtcccgctgatcctg
caaacctcggtcgttggtgataaacctaactcagccaccacagcacaggtatgggcgcag
atcgagaaagacctgacggatgccgctgcggtactgcccacaacctacggcaatgccgat
ctgggccgcgctaccaaaggggccgcttatgccctgctggccagagcgcagatgcagcag
cagaaatataccgaagcactcacaccccttcaatggctggtggaaggcgatgggaaaagc
gtgtactcgctgatgcccaactaccgcgacaatttcctgatcacgaccgaaaataataag
gagtctgtgttcgaatggcagttccagatcaacccggccgaatacaccgacgacgacacc
gaaacgccaaaccagaactacggcacctcgctggcgaagttttttggcccgccaccggtt
ggctggtcggatggcgaagcgcaacgctggcctacccgcgaattcaccgaacgcacaaca
accggcgcccgcgacccgcgtctggaagcgtcgtttctcttcgactcgaccgatgtgcgt
ggccctgatttcacccagatttacgggcagacgttcacccagcggtacggacgggataac
aaacgggtatggttccggaagttccagaacgatcactggaaaactgaagaagattatcgg
tcgcccaacaactggcgatacattcgctacgccgatgtactgctgatgtatgccgaagcc
ctcaacgcgaccggcaaaacaacgcaggcctatacgtacgtcgatcaggtgcgtcagcgg
gcgggactgcctacgctgaccgttgcgaaacccggactcacgcaggcccagtttctggcc
cagctaaagcacgagcggttactggagttatcgggcgaaggctggcgctggaacgatctg
gcccgttggggtgacctcggtccgcaattagccccgcgtgacccagctttctctaccttt
gtgaaaggcaagagtgagttgctgcccattccgcagcttgaccgggatctgaacccgaat
ctggtgcaaaacccgaattactga

DBGET integrated database retrieval system