KEGG   Spirosoma linguale: Slin_3402Help
Entry
Slin_3402         CDS       T01156                                 

Definition
(GenBank) haloacid dehalogenase
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4117043..4117777)
Genome map
AA seq 244 aa AA seqDB search
MQPIELVVFDMAGTTVTDQHEVERCFAEAAVETGLSVSDERILAMQGLSKRYVFETLWKE
QLGEDSPVVQSQVDISYDAFRRILENHYLTKGATPTEGCLETFAYLHERGIAIALTTGFY
RVVTDIILEKLGWLDGLNDQRIGTPDSLLQISIASDEVERGRPYPQMIERAMHLLGVTNP
KAVVNIGDTPSDLLSGRAAGVALNLGLTNGTHTREQLEQHPHDLLLGSLRELPALLEKRE
LSFT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattgaattagtggtatttgatatggccggtactactgtaaccgaccagcac
gaggtagaacggtgtttcgccgaagctgccgttgaaacgggtttgtcggtttccgacgag
cggattctggcaatgcaggggctctccaaacgctatgtgtttgaaacactttggaaggaa
cagctcggtgaagatagtcccgtcgttcaatcacaggttgacatttcatacgatgcgttc
cgtcgtattttggaaaatcactacctcaccaagggagctacgcccaccgaaggttgcctg
gaaacttttgcctacttacacgaacgaggtatcgctattgcgctcacaacgggattttac
cgggtggtaaccgacattattctggaaaaactcggctggctcgatgggcttaacgaccaa
cgtattggtactcccgatagtctgctacagatctccattgccagcgatgaggtagaacgg
ggccgcccgtacccccaaatgatcgagcgggccatgcatctgctgggcgtaacgaacccg
aaagccgttgtgaacattggcgatacaccatccgatttgctctcgggacgagccgccggg
gtagcgctgaatctgggcctaaccaatggtacccatacccgcgagcaactggaacaacat
ccgcacgacttgttgctggggtcactccgggaattacccgcccttctggaaaagcgtgaa
ctatcttttacctaa

DBGET integrated database retrieval system