KEGG   Spirosoma linguale: Slin_3403Help
Entry
Slin_3403         CDS       T01156                                 

Definition
(GenBank) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
  KO
K01815  
4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase [EC:5.3.1.17]
Organism
sli  Spirosoma linguale
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Slin_3403
Enzymes [BR:sli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.17  5-dehydro-4-deoxy-D-glucuronate isomerase
     Slin_3403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4118355..4119215
Genome map
AA seq 286 aa AA seqDB search
MDDKTASQTIFESRYASSPGEVKGMDTTQLRQNFLIDSLFVPNQFKWVLSFFDRYLTGGI
MPIDGPVTLDTPDQLKASYFLERRELGIINVGGAGQVIADGTSYDLDYKEALYIGQGTQA
IQFVSHDANAPAKFYLNSTPAHKNYPTRKVSRTDAEVVTLGSMETANHRTINKLLVNSVL
PTCQLQMGMTELKAGSVWNTMPAHTHDRRMEVYFYFEVPEGQSVCHFMGQPQETRHIWMQ
NEQAVISPNWSIHSGSGTSNYTFIWGMAGENLDYGDMDFCAITDLK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtggatgacaaaacagcatcccagactattttcgaaagccgttatgcttcttcgccgggc
gaggtgaaaggtatggatacaacgcaactgcggcaaaattttctgatcgattcactcttc
gttcccaatcaattcaagtgggtattatcgttttttgaccgttacctgaccggtggaatt
atgcccattgatggccccgttacgctcgacacgcccgaccaactcaaggcaagctacttt
ctggaacgccgtgaactgggtattataaacgtagggggcgctggtcaggtcattgccgat
ggcacctcctacgacctcgattacaaagaagccctgtacatcggtcagggtacgcaggcc
attcaatttgtttcgcacgatgcaaatgctccggctaaattctacctcaactcgacacct
gctcataaaaattacccgacccgtaaggtatcccgcaccgatgccgaggtggttacgtta
ggcagcatggaaacggccaaccaccgtacgatcaataaactgttggtcaacagcgtatta
ccgacctgccagttgcagatgggcatgaccgagctgaaagccgggagcgtctggaatacc
atgcccgcccacacccacgaccggcgtatggaagtgtatttttatttcgaagtacccgaa
ggccagagcgtttgtcattttatgggccaaccgcaggaaacacggcatatctggatgcag
aatgaacaggccgttatttcgcccaactggtcgattcactcaggttccggcacatccaac
tatacctttatttggggtatggcgggcgaaaacctcgattatggcgatatggatttctgc
gcaataacggatttgaagtaa

DBGET integrated database retrieval system