KEGG   Spirosoma linguale: Slin_3407Help
Entry
Slin_3407         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4122693..4123658)
Genome map
AA seq 321 aa AA seqDB search
MECIFNELSANPVETVTEAGKVMAHFVGSVVAAQQFGLERVRLTEEIGNDLYNLPLASDY
TVGSWLSDERVDPVLRDRFRQIAANPPLLKDDEIEALSVFERSIFCLIEPAGTPEAKGFG
AAYLGNWLLLSLLTHDQWNTRQISGWHWFLDNDGQEKTENVIVSHFATVADVELHKPWIQ
RQQNELLQRSIDVWEKRTEFFSDIILCGDVQKQLRKVGMSSYLTQIIARLRTLNGFAASW
TSGDFDLTALKTKTNLDVSVESPSTMNLHSASRRFKLPDGRRELFEMHIKTGNFRFHFYA
DNQNRKVYVGYIGPHLPTATG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtatttttaatgaactttcggctaatccggttgagacagtaaccgaggcaggt
aaagtgatggcgcactttgtgggaagcgttgttgcggctcagcaatttggtttggagcgg
gtacggttaactgaagagattggtaacgatttgtacaatctgccgttggcctctgactac
acggttggtagttggcttagcgacgaacgggttgatccggtgttgcgggatcgctttcgg
cagatcgctgccaatcctcccttgttaaaagacgatgaaattgaggctctgtctgtattt
gagcgatctatattttgcctgatcgaacctgccgggacaccagaagctaaggggtttggt
gctgcttatctgggtaattggttattgcttagtttgctaactcatgaccaatggaatacc
aggcagattagtgggtggcactggtttttagacaatgacggtcaggagaaaacagagaat
gtaatagtctcacattttgctacagttgcggatgttgagttgcataaaccatggatacag
cggcaacaaaatgaactgctgcaacgcagcattgatgtctgggaaaagcgaacagagttt
ttttcagacataatcctttgtggtgatgtacaaaaacaactcaggaaagttggtatgtcg
agttatctgacccaaataattgcccgacttcgaacattgaatggatttgcagcaagttgg
actagcggagactttgatttaaccgccttaaaaacaaaaacgaatctggacgtatcggta
gaaagtccctctacaatgaatctgcatagtgcctcacgtcgtttcaagcttccagatggc
aggcgagagttgtttgaaatgcatataaaaacaggaaatttccggtttcatttctacgcc
gataatcagaaccgaaaggtttatgtgggctacataggtccacacttgccaacggcaact
ggataa

DBGET integrated database retrieval system