KEGG   Spirosoma linguale: Slin_3411Help
Entry
Slin_3411         CDS       T01156                                 

Definition
(GenBank) type II restriction-modification protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4126627..4127370
Genome map
AA seq 247 aa AA seqDB search
MILSSAEARIKAKIEEAGKPLKDWDVQINYGIKTGFNEAFIIDGKTKDELVLKCPKSAEI
IRPVLRGRDIGRYQAVFSDLWLLFIPWHFPLQYGSVLNGSSTLAEERFRSDYPIIYQHLL
KYKKELSQRNQAETGIRYEWYAMQRFGANYADDFVKPKIIWGNLNIEATFSIDYQGSYIL
APCNMLTSKNDDLNYLLAILNSPVTTYFMKNQGYSREGGYVEYKRILSSNCLYLKRQMFK
EVKLSCL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgattctgtcctcggccgaagcccgcattaaagccaagattgaagaagctggaaagcca
ctcaaagactgggacgtgcaaataaattacggtattaaaaccggatttaatgaagcgttc
atcattgacggtaaaaccaaagatgaactagttttaaaatgtccaaaatctgctgaaatt
atacgtccagtgttaagaggaagagatattggacgttatcaagcggtgttttcggattta
tggcttctatttattccttggcacttccccttacagtatggatctgtattgaatggaagt
tctacattagctgaagagagatttcgaagtgactatcccattatttatcaacatctactc
aaatacaaaaaagaattatctcaaagaaatcaagctgagacaggcatccgctacgaatgg
tacgcaatgcaaagatttggagctaattatgccgatgattttgttaaacctaaaattata
tggggaaatttgaacattgaagccacctttagtatcgattaccaaggtagttatatactc
gcaccttgtaatatgcttacgtctaaaaatgacgatttaaattatttacttgcaatatta
aactcgccagtcactacttattttatgaagaatcaaggttatagtcgtgagggtggttac
gtagagtacaaacgaattttatcgagcaactgcctatacctgaagcgtcaaatgttcaaa
gaggtaaaattgagttgcttataa

DBGET integrated database retrieval system