KEGG   Spirosoma linguale: Slin_3420Help
Entry
Slin_3420         CDS       T01156                                 

Definition
(GenBank) TonB-dependent receptor plug
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4144486..4147716
Genome map
AA seq 1076 aa AA seqDB search
MAKLLPPKLLSDRLIRVSSTQLLLAALCVSFTYAGKPVNPKFPVNQSVKQADRTLTGRVT
DEKSEGLPGVSVILKGTQRGTVTDADGQYKLDVPDGASTLVFSFVGYLPQEVSVGNQTSI
NVSLKTDSKVLDEIVVIGYGTTRKSDLTGAVTGVKEAQLQERPAPSLNQALSGRMPGVQV
NTNSGRPGGRTTVRIRGFSSINSSNNPLYVVDGVMLPQGTGDQFSNPIDYINPNDIVNVE
VLKDASSTAIYGARGANGVILVQTRKGKAGESRVTYDGQFSVNTIGPNKPKVLNAKEYLA
TEDLAYANMAKYDPVGWAAGKWSYLDPIARRKAFSAAHPGVFDANLNPLYDTDWFKESAQ
NKLSQNHQLGFSGGNERTQYSLSLNYRDDQGLIKTSYMKRYSGRFSIDDQVKSWLKIGGT
MSYNYQTENLVDINDAVARQIVEDFPFLPVRYPDTGVFAENRDYPYAEGTMSSVHRLMDR
KYIQNTQTILGSLFTNITFGKGLEMRTVLGTNVQTQEINQSQTRTLNIGNNGNASTNNNR
QNFWSLENYLTYNKQFGQDHSFTGLLGLSWQETNTFGIGASVSGFATDYFGFNNLGAGAI
NPSVSSGASRFAFNSYFGRINYGYKNKYLFTATGRADGSSKFGENHKFAFFPSAALAWRV
SEEDFLKGNPVISNLKVRTSYGLTGNSEIPPYSSLSLLSSNYATIYNDTKVSGTGINRLA
NPDLRWEKTAQTDVGLEVGFLKGRISLEADYYYRLTTDMLLDAPVPQSSGYATIRRNVGS
MENKGFEFGVNTVNINRGTFSWNTSFNISLNRNKVLSLATPSDIFNVGGPNFTNPTNVIR
VGEAVGSFWGLTRVGVWSEAEREEAAKFTSYRNGLTILPGDIKYLDVNGDKAITDADRSI
IGNGSPKGWGAMTNNIRLGNFDATLELQYMFGNDVMLMNLHPSEDRQALANSYSSVLNAW
TPTNQGSQIAQVRDTRAGYVTNVDSHWIKDGSFLRGRNLLFGYTLPANVTSKLKMNRLRV
YVSAQNFFLLLKDPIVGDPEVTPTNQGTGNSAFSQGMIWHNYPKPTTYLLGLQIGL
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactcttaccacctaaactcctgtccgataggttaattagagtttcaagcact
caactcctactggcagctttgtgtgttagttttacttatgcgggaaagccggttaatcca
aaattccccgtcaatcagtcagtgaagcaggctgaccgtacactcacaggccgggtaaca
gacgaaaagtccgaaggacttcccggcgtgagtgttatcctgaaaggaacccagcgcgga
accgtaaccgatgccgatggacagtataaacttgacgtacccgatggggcctctacactt
gtgttctcctttgttggttacctgccacaggaagttagtgttgggaatcaaacgtcaatc
aacgtcagcctgaaaaccgacagtaaagtactggatgagatcgtagtcatcggctatggt
acgacgcgcaaatccgaccttaccggcgctgtcaccggcgtgaaggaggcccagttgcaa
gagcgccctgcgccttcgttgaaccaggccctgtcaggtcgcatgcccggcgtgcaggtc
aacaccaactcgggacgacccggcggtcggaccaccgtccgtatccggggcttcagctcc
atcaactcctccaacaaccccctctacgtcgttgatggcgtcatgctcccccaaggtacc
ggcgaccagttcagtaacccaatcgattacatcaaccccaacgacatcgtcaacgtggag
gtcctgaaagatgcctcttcgacggctatctacggggctcgtggcgccaacggcgttatt
ctggtacaaactcgtaaagggaaagccggtgaaagccgggtcacctacgacggtcagttc
agcgttaacaccatcggacccaacaagccaaaggtgctcaacgccaaggagtacctggct
accgaagacctcgcctatgccaacatggccaagtatgaccccgttggctgggccgcgggt
aagtggtcttacctggacccgatagcccggcgcaaagccttcagcgcggctcaccctggt
gtgtttgatgccaacctgaacccactctacgacaccgactggttcaaggagtcggctcag
aacaagctttcccagaaccaccagttaggtttcagtggcggtaacgagcgcacccagtac
tccctctcgctgaactaccgcgacgatcagggtctgatcaagacctcctacatgaagcgt
tactcgggtcgtttctcgatcgatgatcaggtcaagagctggcttaagattggcgggaca
atgagctacaactaccagacggaaaacctggtggacatcaacgatgcggtggcccgtcag
atcgtcgaagacttccccttcctgcccgtacgctacccggacaccggcgtcttcgccgag
aaccgggactacccttatgcagaaggcaccatgagttcggtacaccgcctgatggaccgt
aagtacatccagaacacccagactattctgggcagtttgtttaccaacatcactttcggc
aaagggctggagatgcgtacagtactgggtaccaacgtccagacgcaggagattaaccag
tcgcaaacccgtacgcttaacattggcaataacggtaacgcatcgaccaacaacaaccgg
cagaatttctggtcgttggagaactacctgacctacaacaaacagtttggtcaggatcac
tccttcaccggactactaggtctgtcgtggcaggagactaacacctttggcatcggtgcc
agcgtaagcggttttgccaccgactacttcggctttaacaacctgggcgctggtgcgatc
aacccatcggtgagttcgggtgcttcacggtttgcctttaactcctacttcggtcggatc
aactacggctacaagaacaagtacctcttcaccgctaccggccgggctgatggctcctcg
aagttcggagaaaaccacaagtttgccttcttcccctcggcggctctggcctggcgggta
tcggaagaagacttcctgaaaggcaaccccgttatctcgaatttgaaagtgcgcaccagc
tacggtctgacgggtaactccgagattccgccttactcctcgctctcgctgttgagttca
aactacgctacgatctataatgatacgaaggtgagtggcacgggtatcaaccgtctggct
aaccccgacctgcgctgggaaaaaaccgctcagactgatgtaggtctggaagttggcttc
ctcaaaggacgcatctcgctggaagccgattactactaccgtctgacaaccgacatgctc
ctggatgcccccgtaccacaatcgagcggctatgccaccattcggcgtaacgtaggctcg
atggagaacaaaggttttgagttcggagtgaacacggttaacatcaaccggggtactttc
agttggaacacctccttcaacatctcccttaaccgcaacaaagtcctctccctggctact
ccgtctgacatcttcaacgtaggtggtcctaacttcactaaccccaccaatgtcatccgg
gtaggtgaagcagtaggttcgttctggggtctgacccgggtaggcgtatggagtgaagcg
gagcgggaagaagcggccaagtttaccagctaccgcaacggtctgaccattctgcccggc
gacatcaagtacctcgacgtaaacggcgacaaggccatcaccgatgctgaccgcagcatc
attggcaacggtagtcctaaaggctggggtgccatgaccaacaacattcgtctgggcaac
ttcgatgccaccctggaacttcagtacatgtttggtaacgacgtcatgctgatgaactta
caccccagtgaagaccggcaggctctggccaacagctactcgtcggtgctcaacgcctgg
acgccaaccaatcagggtagccagattgctcaggtacgcgacacacgggcgggctacgta
accaacgtcgacagtcactggattaaggacggttcgttcctgcggggccgcaacctcctg
tttggctatacgctgccggctaacgtaacgtctaaattaaagatgaaccggttacgggta
tacgtttccgctcagaacttcttcctgttgctgaaagatcctattgttggtgatccggaa
gtaacgcccaccaaccagggaacaggcaacagcgccttctcacagggcatgatctggcac
aactaccctaaaccaactacctatctccttggtctgcaaattggcttgtag

DBGET integrated database retrieval system