KEGG   Spirosoma linguale: Slin_3422Help
Entry
Slin_3422         CDS       T01156                                 

Definition
(GenBank) peptide methionine sulfoxide reductase
  KO
K07304  
peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
sli  Spirosoma linguale
Brite
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     Slin_3422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4149550..4150212
Genome map
AA seq 220 aa AA seqDB search
MKGIHVLAFSLLLLAGCAQGQSKDYAPAKLPALKPGEAVATFAGGCFWALEEGMNQLKGV
REVISGYAGGHVKNPTYEQVGTDETGHAESVQVYYDPKVISYPQLLDAFFAGHDPTTLNR
QGPDVGRDYRSVAFYRTPAEKAEILAAIKRTNDSKHYANPVVTEVTPITDFYPAENYHQN
YFALHPDQPYIQRVSLPKVEKLRKAMAGHLKNNTSLTMNN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaattcacgtattggcgttcagtctgctgttgctggcagggtgtgcgcagggc
caatcgaaagactacgcacccgctaaacttcctgccctgaaaccgggtgaagcagtggca
accttcgcaggcggctgcttctgggcgcttgaagaagggatgaaccagttgaaaggtgtt
cgggaagtaatctcaggttatgcgggtgggcacgttaaaaacccgacctacgaacaggta
ggcactgatgaaacggggcatgcagaatctgttcaggtgtactatgatccgaaagtgatc
agctacccgcaattactcgatgctttttttgccggtcatgaccccaccacactgaaccgt
caggggcccgacgtaggccgcgattatcgatcggtggctttttaccggacacctgccgaa
aaagccgaaatcctggcggctattaaacgaaccaacgactcgaagcattacgcgaatccc
gttgtaacggaagtaacgcctatcacggatttttatccggccgaaaattatcaccagaat
tactttgcgcttcaccccgaccagccttacatccagcgcgtatctttaccaaaagttgag
aaactccggaaagcaatggccggtcatctgaaaaacaatacgtcgttaacgatgaataac
tag

DBGET integrated database retrieval system