KEGG   Spirosoma linguale: Slin_3426Help
Entry
Slin_3426         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHU_C
Motif
Other DBs
NCBI-GeneID: 8727179
NCBI-ProteinID: ADB39434
UniProt: D2QPC6
Position
complement(4152621..4154111)
Genome map
AA seq 496 aa AA seqDB search
MFLSEQVAGQNLVPNGSFETYSNCPRQDNLLIEAIPWYNPNRATPDFYNTCFQTGQMSLP
PHSGQGVGRLFFDQGWAEYLGVRLTKPLDAKECYYFEMYVATDAPTKYQTETLGAYFSTD
PVTNPASTDRFVLQPQILDNSPQGSIAGLQWHRIAGFLTAKGGEQYVTIGSFTKTPPFLG
FYYLFVDDISLVPTKLELGNDSTLCGRKSTLLLDATTPGASYYRWNDGSTTPTLLVTRPG
KYSVTAVTNCKTLRDSITIDYALDFDLGADTTLCNGKTLTLKVPATAGSTYRWQDGSRQS
TLTVQQEGLYRIQVTQASCVASDSIYVRYIRPPQLDLGPDQSLCGAQLFTVKPTVSEGKF
SWLDQVTGVERTVSSSGVYRASVQNDCATVLDSVLIDYEACECILYAPSSFTPNGDGLND
LFLAYGCGDITITSLAVFDRWGEVIFQTSNAPFQWDGQYRGELCEVGVYAWSIQYQLNQR
GKSTSGQKQGALTLLR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgtctgaacaggtagcggggcaaaatcttgttcctaacggcagctttgaaacg
tacagtaattgccctaggcaggataacctgctcatcgaagctataccctggtataaccct
aatcgtgccactcccgacttctataacacctgttttcagaccgggcaaatgtctttacca
cctcattcgggccagggagtagggcgtttgttctttgatcagggatgggcagaatacctg
ggtgtacggcttacaaagccactcgatgccaaggagtgctattacttcgaaatgtacgta
gctacggatgcgcctactaaataccagaccgaaacgcttggggcttatttttcgaccgac
ccggtcacgaatccagcatcaacggatcgattcgtccttcagccgcaaattctggataat
agtccccaaggtagtatcgctggtctgcaatggcatcgcatagccgggtttctgactgcc
aaagggggggagcaatatgttaccattgggagctttacaaaaacgccccctttcctgggg
ttttattacctattcgtcgacgatatttcgctggttcccactaaacttgagttggggaat
gactctacgctctgtggccgcaaaagtactctgctactggatgccaccacgccgggtgca
tcctattatcgctggaatgacggtagtacaacccccaccttgctggttacccggcccggt
aagtattctgtaaccgccgtaacaaactgtaagaccctacgggatagtattacaattgat
tacgcactggactttgacctgggggctgataccactctctgtaatggcaagacacttacc
ctgaaagtcccggcaacggccgggtcaacctatcgatggcaggatggttcccggcaaagc
acgctgactgttcaacaggaggggctgtaccgtattcaggtcacacaagccagttgtgtg
gcctccgatagtatttatgtgcggtacatccggccccctcagctggatttgggaccggat
cagtccttgtgcggagcgcagctgtttaccgtaaagccaaccgtgtccgaaggtaagttt
tcctggctggatcaggtaacgggtgtcgaacgaacggtaagcagttcgggcgtatacagg
gccagtgttcaaaatgattgtgcaacagtactcgactcggttctgattgattacgaagcc
tgcgagtgtattctgtatgcgccatccagctttacaccaaatggtgatggcctgaatgat
ctgtttctggcctatggttgtggcgatatcacgattacatccctggcggtgttcgaccgg
tggggtgaagtaattttccagacgtctaacgccccgtttcagtgggatggacagtatcgt
ggtgaactttgtgaggtgggggtgtatgcctggagtattcagtatcagctgaatcaacgg
ggaaaatcaacatccggccagaagcagggggcacttaccctccttcgctag

DBGET integrated database retrieval system