KEGG   Spirosoma linguale: Slin_3435Help
Entry
Slin_3435         CDS       T01156                                 

Definition
(GenBank) oxidoreductase domain-containing protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4161733..4162878)
Genome map
AA seq 381 aa AA seqDB search
MQKINIGVVGTGFIGPAHIEALRRLPNTNVLALCEVTPELARQKADQLGIERSCTFEELL
AMDDIKVVHICTPNFLHYSQSKAALLAGKHVVCEKPLAKDLHEAKELVELAEQTGLVNAV
HFNLRYYPLVRQMKVMREQDALGDVYSVIGSYLQDWLFYDTDYNWRLEPDKSGDSRAIAD
IGSHLMDSLEYITGLKTVAVMADFNTVHKVRKKPLKPVETYSGKMLQPEDYADVPINTED
HANVLLRFDNGNRGVITVSQVSAGRKNQMKLEIAGSKKTFAWNSEAPNEMWIGNRDGANE
ALMRDPSLAHPEARSVISFPGGHNEGFPDTSKQLFKEVYAAIEAGKQPENPTYPTFADGY
RELLICEKILESNRKQAWVEI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatcaacatcggtgtcgttggcaccggattcatcgggcctgcgcacatcgaa
gccctgcgtcgccttccaaacacaaacgtcctcgccctgtgtgaggtgactcctgaactg
gctcgtcagaaagccgatcagctcggtattgagcggtcctgcacgttcgaggagcttctg
gccatggacgatattaaggttgtacacatctgtacgccgaacttcctccattactcacag
tcaaaagcagctttgttggctggcaagcatgttgtgtgtgagaagcctctggccaaagat
ttacacgaagccaaagaactcgttgaactggctgaacaaactggtctggtcaatgccgtg
catttcaacctgcgctattacccgctggttcgccagatgaaggtgatgcgtgagcaggat
gccctgggcgatgtgtactcggtgatcggttcctatttgcaggactggctcttctacgac
accgattacaactggcgtctggaacccgacaagtcgggcgattcgcgtgccattgctgat
attggctctcacctgatggacagcctcgaatacattacgggcctgaaaacggtagccgtt
atggccgatttcaacacagtccataaagtgcggaaaaagccgctgaagcccgtggagacg
tattcgggcaagatgctccagcccgaagattacgctgacgtccccattaataccgaagac
catgccaacgtattactgcggttcgataatggaaatcggggtgttatcacggtgtcgcag
gtgtcggccggtcggaaaaaccagatgaagctggagattgccggttcgaagaaaacgttt
gcctggaactccgaagcacccaacgaaatgtggatcggtaaccgcgacggtgccaatgaa
gcattgatgcgcgacccatcgctggctcaccccgaagcgcggtcggtgatcagttttcct
ggcggtcacaacgaaggtttccccgacacgtcgaagcagttgttcaaagaggtgtatgcg
gctattgaagcggggaaacaacccgaaaatccgacgtacccaacctttgccgacggttac
cgcgagctgctcatctgcgaaaaaatcctggaaagcaaccgcaaacaggcgtgggtggag
atttaa

DBGET integrated database retrieval system