KEGG   Spirosoma linguale: Slin_3438Help
Entry
Slin_3438         CDS       T01156                                 

Definition
(GenBank) late embryogenesis abundant protein 2
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4165849..4166763)
Genome map
AA seq 304 aa AA seqDB search
MKKGWLIALGLLLIGCIGAYVWYRNVKDERTAEGKPYDDTLKPRLEMTRMAITDISEDVI
SMNLYMLIDNPLPVGFKSPSLDYTFYIANTPVMVDAYKKPIEVKSGDSTLVVLPARLAYK
KLASVLKTLDRKDIDSTNYKMRAKFALDIPILGQKTFETTVDKRMPTFYLPEVKIDDIDF
GKLGLKRTDVAAKVSITNKNKMPFSITDAHYTVFIDGKEIADGEQTEPIRIKAQATTPVV
FPVTARPGKTLSVLPKMLFDKKDTPYRVNFRCKLIDKENNSSFANSKFVSTITGTLDDFK
KLKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggatggttgattgcattggggctattactgattggctgtattggtgcctat
gtctggtatcgaaatgtaaaagatgaacgtacggcagaaggaaagccctatgacgatacc
ctgaaaccccgactggaaatgactcgtatggccatcaccgatatcagcgaagacgttatt
tctatgaatctgtacatgctgatcgataaccccctgcccgttggttttaaatcacccagc
ctggattacacgttttacatcgccaacacgcccgtaatggtcgacgcgtacaagaagcca
atcgaagtgaagtccggcgacagtacgctggttgtgctccccgccaggctggcctacaaa
aagctggcaagcgtactgaagacccttgatcgaaaagacatcgatagcactaattacaag
atgcgggcgaaattcgcgctcgacatacccattctggggcagaaaacctttgagactaca
gttgacaagcgaatgcctacgttttacctgccagaggtcaaaattgatgacatcgacttt
ggcaaactgggactaaaacgaaccgatgtagccgcaaaagtgagtatcactaacaagaac
aagatgccgttcagcataaccgacgcgcactatacggttttcattgacggaaaagagatt
gccgacggtgaacaaaccgagccaattcggatcaaggcgcaggcaacgacgcccgttgta
tttccggtaacggcccggcccggtaaaacgctgagtgtattgccaaagatgctgttcgac
aaaaaagacacgccctatcgggttaacttccggtgtaaactcatcgacaaggaaaacaac
tcgtcgtttgccaacagcaaattcgtatcgacgattaccgggacgctggacgattttaag
aagctgaagaagtga

DBGET integrated database retrieval system