KEGG   Spirosoma linguale: Slin_3540Help
Entry
Slin_3540         CDS       T01156                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sli  Spirosoma linguale
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Slin_3540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_3540
  Lipid metabolism
   00071 Fatty acid degradation
    Slin_3540
  Amino acid metabolism
   00350 Tyrosine metabolism
    Slin_3540
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Slin_3540
   00626 Naphthalene degradation
    Slin_3540
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Slin_3540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4272724..4273737)
Genome map
AA seq 337 aa AA seqDB search
MKAAVLHGYGQPLQLETIPVPTVGPGQILVKVAACGVCHTDLHAIDGDWPVKATLPLIPG
HEGVGTVVAVGAGVTHIHEGDRVGVPWLYSACGHCEYCYSGWETLCHNQQNTGYSVQGSY
AEYVVANPDYVGHIPDSLSFIDAAPILCAGVTVYKGLKETEVKPGEWVVISGIGGLGHLA
VQYAKAMGMHVVAVDISSEKLALASEVGADLTINAATEDPATIVQDKIGGAHGVLVTAVS
RTAFAQGVDMLRRKGTLSLVGLPPGDFDVNIFDVTLNRKTIRGSIVGTRQDLTESLAFAA
DGKVHVHYRTERLDNINQVLADMKAGQIDGRVILDFQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggctgtcctgcacggatatgggcagccattacaactcgaaacgattccggta
ccaaccgttggacccggtcagatactggttaaagtagccgcgtgtggcgtttgtcatacc
gatttgcacgccattgatggcgactggcccgttaaggccaccctgccgctcattcccggc
cacgaaggcgtgggtaccgttgtggcggtgggagcgggcgtaacccatatccacgaaggc
gaccgggttggtgttccctggctttactccgcctgtgggcactgcgaatactgctattcg
ggttgggaaacactttgtcataatcagcagaatacgggctattcagtgcagggaagctat
gccgaatacgtagttgccaaccccgattatgtaggtcatattcccgatagcctgtcgttc
atcgacgcggcccccatcctctgtgctggcgtgacggtatataagggtctgaaagaaaca
gaagtaaaaccgggcgaatgggtagttatttcgggtattggcgggctgggtcacctggcc
gttcagtatgccaaagccatgggtatgcacgtggtagccgtcgatatcagctccgaaaaa
ctggcgctggcgagcgaagttggtgccgatctaacgataaacgcggccaccgaagatcct
gccactattgttcaggacaaaattggtggagcgcatggcgtactggtgaccgccgtttcc
cgaacggccttcgcacagggcgtggatatgctgcgccggaaaggaacgctctcgctggtt
ggtttgccaccgggtgattttgatgtcaatatcttcgacgtaaccctgaaccggaaaacc
attcgcggctccatagtgggtacgcggcaggatttaactgaaagtctggcttttgccgcc
gatggcaaagtacacgtccattaccgaaccgaacgactcgacaacatcaaccaggtactt
gccgatatgaaagcgggacagattgacggccgcgttattctggattttcagtaa

DBGET integrated database retrieval system