KEGG   Spirosoma linguale: Slin_3541Help
Entry
Slin_3541         CDS       T01156                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sli  Spirosoma linguale
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sli01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sli01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sli00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sli00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sli00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sli00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:sli00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4273888..4274886
Genome map
AA seq 332 aa AA seqDB search
MTGAPTDSFVPHAYINVHHMLVTLTLNPAVDISMTIDRLIPEQKLHCSQPRYDAGGGGLN
VSKAIHRLGGASTALFTSGGSAGLTLQDLVKKEGIDYELIDIDGLTRECFVVTETVPNNQ
FRFGTPGPILSPGEASACLARLKTMPNPIDYLIASGSLPPGLPVDFYAHIARIAKQRDIR
LVLDTAGEALQAALEEGVFLIKPNLGELAHLVGVERLETVQIVEAAQSLIQAGRCQVVVV
SQGPRGATLVTSNEHEFVQAPLIEKVSTVGAGDSLVGGMVYALSQGKSFSDMIRLGVACG
TAATMNPGTELFHKADVDRLLNWINQQQTCWV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggcgcaccgactgactcgttcgtgcctcacgcttatataaacgtacatcatatg
ctcgttacgctcacgctcaacccggccgtggacattagcatgaccattgaccggctaatt
cccgaacagaagctccattgctcccagccccgttacgatgccggtgggggcggtctcaat
gtatccaaagccattcatcggctgggcggtgcctcaacggccctgttcacgtcgggcggt
tcggcggggcttaccctacaggacctggtaaaaaaggaaggtatcgactacgaactaatc
gacatcgatggcctgacgcgtgagtgttttgtggttacggaaaccgtacccaacaaccag
tttcgatttggtacgcccggccctatcctcagtccgggtgaggccagtgcctgtctggcc
cggctgaaaacaatgcccaacccgatcgattatctaattgccagcggtagtttaccaccc
ggcctgccagtcgatttctacgcgcacattgcccgtattgccaaacagcgggatattcgc
ctggttctcgacacagccggagaggctttgcaggcggcccttgaggagggcgttttcctg
attaagcctaacctgggcgaactggctcaccttgtgggtgtggaacggctcgaaacggtg
cagattgtcgaagcagcccaaagcctgattcaggcaggccgctgccaagtcgttgttgtt
tcgcagggtccgcggggagctacgctggtaacatccaacgagcatgagtttgtgcaggca
cccctgattgaaaaagttagtaccgtgggggccggtgacagtctggtggggggaatggtc
tacgccctgtcgcaggggaaatcgtttagcgatatgattcggctgggggtggcctgcgga
acagccgccaccatgaaccccggcaccgaactctttcacaaagccgacgtcgaccgattg
ctgaactggattaaccagcaacagacatgctgggtttag

DBGET integrated database retrieval system