KEGG   Spirosoma linguale: Slin_3541Help
Entry
Slin_3541         CDS       T01156                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sli  Spirosoma linguale
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slin_3541
   01230 Biosynthesis of amino acids
    Slin_3541
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_3541
   00030 Pentose phosphate pathway
    Slin_3541
   00051 Fructose and mannose metabolism
    Slin_3541
   00052 Galactose metabolism
    Slin_3541
  Energy metabolism
   00680 Methane metabolism
    Slin_3541
Enzymes [BR:sli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Slin_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4273888..4274886
Genome map
AA seq 332 aa AA seqDB search
MTGAPTDSFVPHAYINVHHMLVTLTLNPAVDISMTIDRLIPEQKLHCSQPRYDAGGGGLN
VSKAIHRLGGASTALFTSGGSAGLTLQDLVKKEGIDYELIDIDGLTRECFVVTETVPNNQ
FRFGTPGPILSPGEASACLARLKTMPNPIDYLIASGSLPPGLPVDFYAHIARIAKQRDIR
LVLDTAGEALQAALEEGVFLIKPNLGELAHLVGVERLETVQIVEAAQSLIQAGRCQVVVV
SQGPRGATLVTSNEHEFVQAPLIEKVSTVGAGDSLVGGMVYALSQGKSFSDMIRLGVACG
TAATMNPGTELFHKADVDRLLNWINQQQTCWV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggcgcaccgactgactcgttcgtgcctcacgcttatataaacgtacatcatatg
ctcgttacgctcacgctcaacccggccgtggacattagcatgaccattgaccggctaatt
cccgaacagaagctccattgctcccagccccgttacgatgccggtgggggcggtctcaat
gtatccaaagccattcatcggctgggcggtgcctcaacggccctgttcacgtcgggcggt
tcggcggggcttaccctacaggacctggtaaaaaaggaaggtatcgactacgaactaatc
gacatcgatggcctgacgcgtgagtgttttgtggttacggaaaccgtacccaacaaccag
tttcgatttggtacgcccggccctatcctcagtccgggtgaggccagtgcctgtctggcc
cggctgaaaacaatgcccaacccgatcgattatctaattgccagcggtagtttaccaccc
ggcctgccagtcgatttctacgcgcacattgcccgtattgccaaacagcgggatattcgc
ctggttctcgacacagccggagaggctttgcaggcggcccttgaggagggcgttttcctg
attaagcctaacctgggcgaactggctcaccttgtgggtgtggaacggctcgaaacggtg
cagattgtcgaagcagcccaaagcctgattcaggcaggccgctgccaagtcgttgttgtt
tcgcagggtccgcggggagctacgctggtaacatccaacgagcatgagtttgtgcaggca
cccctgattgaaaaagttagtaccgtgggggccggtgacagtctggtggggggaatggtc
tacgccctgtcgcaggggaaatcgtttagcgatatgattcggctgggggtggcctgcgga
acagccgccaccatgaaccccggcaccgaactctttcacaaagccgacgtcgaccgattg
ctgaactggattaaccagcaacagacatgctgggtttag

DBGET integrated database retrieval system