KEGG   Spirosoma linguale: Slin_3893Help
Entry
Slin_3893         CDS       T01156                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sli  Spirosoma linguale
Pathway
sli00511  Other glycan degradation
sli00520  Amino sugar and nucleotide sugar metabolism
sli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Slin_3893
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Slin_3893
Enzymes [BR:sli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Slin_3893
Chaperones and folding catalysts [BR:sli03110]
 Intramolecular chaperones
  Others
   Slin_3893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b PA14 CHB_HEX_C_1 Fn3_assoc Glycohydro_20b2 CHB_HEX_C GLEYA
Motif
Other DBs
NCBI-GeneID: 8727651
NCBI-ProteinID: ADB39883
UniProt: D2QHT4
Position
complement(4669658..4671940)
Genome map
AA seq 760 aa AA seqDB search
MQIKPIIFIVGLSLLMAGIGQSQTPDPYPIIPYPTSLVPGQGQFVITQNTALVVQDGRFQ
SEAGQLQQLLKPVLGKPLPARGGNAQIVLNYDPSITSPEGYQLTIAPQRITLAAREPVGM
FRAIQTIRQLLPVSLEQKKTTGPLTLPAVQIRDQPAYAWRGMHLDVSRHFFSMDYLHKFV
DLLALYKFNKFHLHLTDDQGWRLEIKAYPKLTSEGAWRTFNNQDSVVLKRATTNPDFDLP
KQYLRQKDGKTQYGGFYTQNQMRELIAYAAARHIEIIPEIDMPGHLTAAIKAYPFLSCTG
QEGWGKTFSVPICPCNEPTYTFTETVLSEVAALFPSQYIHIGADEVEKSTWAQSTACQAL
MKREGIKSVEELQSYFVHRTEKFLLSKGKKLMVWDDALEGGLAPSATVMYWRSWVTDAPV
KAVRNGNPVVMTPVNTLYFDVLPDKNSLANVYQFNPVPTGLTPAEATSILGAQANTWTEY
IPSENRVDYMVMPRMTALAERLWTNQNQYDTYRQRLTRHYPRLDALGVHYRVPDLSGFAE
ENVFTDQTALRIRKPTDNLVVRYTIDGSLPKAASALLPESLPISQPTTVKLAAFTNSGLQ
GDVYTLRYQQQSLAEPVGVSSVGAGLMSTYVKGQFKNVAAMLKAPASDSVVVNQVKVPEM
AGAGSFGVRFRGYISVPATGIYSFFLVADDGGVLHIANRTVIDNDGNHGPIEKSGQVALK
RGTHPFALDFIEAGGGYTLKLLYSRDGSDPQPVPADWLGH
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcaaaccgatcattttcatcgtcgggctcagtctgctgatggccggtataggt
caatcgcaaacgcccgatccataccccattatcccgtacccgacttcgctggtaccgggt
caggggcagtttgttatcacccaaaataccgcgctggttgtccaggatggtcgtttccag
agcgaggccggtcagttacagcaattgctgaaaccggttttgggcaagccactgcctgcc
cgtggaggcaacgcgcagatcgtgctcaattacgacccatccatcacgtcaccggaaggc
taccagcttaccatcgccccccagcgcataaccctggcggccagagagccggtgggcatg
tttcgggccattcagaccatccggcaactgctgcccgtgagccttgagcagaaaaaaaca
accggcccactgaccctcccggcggtgcagatccgcgaccagcccgcctatgcctggcgg
ggcatgcacctcgatgtgtcgcggcactttttctcgatggattacctgcataaattcgtc
gatctgctggctctttacaagtttaataaatttcacctgcacctcaccgacgaccagggc
tggcggctggagataaaggcgtaccccaagctaaccagcgaaggagcctggcggacgttc
aataaccaggattctgtcgtgctgaaacgggccaccacaaatcccgacttcgacctgccg
aagcaatacctccggcagaaagacgggaagacgcaatatggcgggttttatactcagaac
cagatgcgcgaactcatcgcgtacgcagccgcccgccatatcgaaatcattccggaaatc
gacatgcccggccatttgacggcggccatcaaagcgtatccatttctaagctgtacgggt
caggaaggctggggcaaaacgttttcggtgcccatctgcccctgcaacgaacccacctac
acgtttaccgaaaccgtactgagcgaagtagccgcgctgttcccgagccagtacatccac
atcggggccgatgaagtggagaaatcgacctgggcgcagtcgacggcctgtcaggcgttg
atgaagcgggagggaatcaaaagcgtggaggaactgcaaagttatttcgtacaccgcacc
gaaaagtttctgctgtcgaaagggaaaaaactcatggtctgggacgacgctctggagggc
ggactggcaccctcggccacggtcatgtactggcggagctgggtgaccgatgcgcccgtg
aaagctgttcggaatggcaacccggtggttatgacgcccgttaacaccctttatttcgac
gtgttgcccgacaaaaattcgctcgcaaatgtctatcaattcaatcccgttccaaccggg
ctgacacccgccgaagcgacatccattctgggcgcacaggccaacacctggacggaatat
attccctccgaaaatcgggtcgattacatggtgatgccccgcatgacggccctggccgaa
cggctgtggaccaatcagaatcagtatgacacttaccggcagcgccttacccggcactac
ccgcgtctggatgcgctgggggttcactaccgcgtgcccgatctgagcggctttgccgaa
gagaatgtgtttacggaccaaacggccctgcgcatccgcaaaccgacggataatctggtt
gttcgctacaccatcgatgggagcttgccgaaggcggcttcggcgctacttcccgagtcg
ttgccgatcagccagccaacgacggtaaagctggcggcttttacgaatagcggcttgcag
ggcgatgtgtatacgcttcggtatcaacagcaatcgcttgctgaaccggtgggagtatcg
tccgtcggggccggattgatgagtacctatgtgaagggacagtttaaaaatgtagccgcc
atgctaaaggcaccggcttccgattcggtggtggtgaatcaggtaaaggtgccggaaatg
gccggagcgggtagtttcggcgttcggtttcggggttacatcagcgttcccgccacgggt
atttacagctttttcctggtagccgacgatgggggtgtgctgcacattgccaaccggacg
gttatcgacaacgacggtaaccacggccccattgaaaaaagcggtcaggtggccctcaaa
cggggtacgcatcctttcgccctcgacttcatcgaagcgggtggcgggtataccctaaag
ctgctgtacagccgcgacggtagtgatccacaacccgtacccgccgactggctggggcat
tga

DBGET integrated database retrieval system