KEGG   Spirosoma linguale: Slin_4275Help
Entry
Slin_4275         CDS       T01156                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sli  Spirosoma linguale
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slin_4275
   01230 Biosynthesis of amino acids
    Slin_4275
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_4275
   00030 Pentose phosphate pathway
    Slin_4275
   00051 Fructose and mannose metabolism
    Slin_4275
   00052 Galactose metabolism
    Slin_4275
  Energy metabolism
   00680 Methane metabolism
    Slin_4275
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Slin_4275
Enzymes [BR:sli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Slin_4275
Protein phosphatases and associated proteins [BR:sli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Slin_4275
Messenger RNA biogenesis [BR:sli03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Slin_4275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5158534..5159508
Genome map
AA seq 324 aa AA seqDB search
MKRVAVFTSGGDAPGMNACIRAVVRGAVYHGIEVFGIRRGYSGMINGDIFQMTSHSVSNI
VQRGGTILKSARSKEFMTPEGRAKAYEQLKKFDIEGLVAIGGNGTFTGATLFFDEYGIPT
VGAPGTIDNDLYGTDHTIGFDTAVNTALEAIDKIRDTADSHDRIFFIEVMGRDSGYIAIQ
SGIAGGAEMVMVPEVLTPISEVVETLKSGWSRQKSSSIVVIAEGEEAGNATEIAEKIRLQ
VQSTIDMRVTTLGHIQRGGIPTAYDRILASRLGLGALEGLMNGEQNVMAGIINNELVYTP
FRDTIRLPKPISEDLLRMVKILSV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagtagctgtttttacctcgggtggcgacgcaccgggtatgaacgcctgtatc
cgggctgttgttcggggggcggtctatcacggcattgaagtgttcggtatccgccggggg
tacagcggaatgataaatggcgatatttttcagatgacttcgcactcggtgagcaacatc
gtacagcgtggaggcactatcctgaaatcggcccgcagcaaagagttcatgacgccggaa
gggcgcgcaaaagcctacgaacaactcaagaaattcgatattgaaggtctggttgctatt
ggcggtaacggcacctttacgggtgctacgcttttcttcgacgaatacggtattccaacc
gttggcgcacccggcacgatcgataacgacctttacggaactgaccatacgattggcttc
gacaccgccgtgaacacggccctggaagccattgataaaattcgcgatacggccgactcc
cacgaccgtattttcttcattgaagtgatgggccgcgactccggttatatcgcgattcag
tcgggtattgccggtggtgctgaaatggtaatggtaccagaagtactgacgccaatttct
gaagttgtcgaaacgctgaaatcgggctggagccgccagaaatcatcgtccatcgttgtc
attgccgaaggggaagaagccggaaatgcgaccgagattgccgagaaaatacgccttcag
gttcaatctaccatcgatatgcgggttacaacccttgggcacattcagcgcggtggcatt
cctacggcttacgaccggattctggccagccgcctgggtcttggtgccctggaaggcctg
atgaatggcgaacagaacgtaatggccgggattatcaacaatgagctggtctataccccg
ttccgtgataccatccgcctgccgaagccaatcagcgaggatttgctccggatggtgaag
attttatctgtgtaa

DBGET integrated database retrieval system